Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate Dsui_3018 Dsui_3018 OAH/OAS sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__PS:Dsui_3018 Length = 433 Score = 275 bits (704), Expect = 1e-78 Identities = 174/424 (41%), Positives = 228/424 (53%), Gaps = 42/424 (9%) Query: 11 GDRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPG--------EHQGFEYSRTH 62 G +L TLA+H GQ PDP GA PIY ++++ E G YSR Sbjct: 3 GKDGYTLDTLALHAGQVPDPQYGARATPIYLSTSFVFKDSDQAAALFNMERAGHVYSRIS 62 Query: 63 NPTRFAYERCVAALEGGTRAFAFASGMAATS-TVMELLDAGSHVVAMDDLYGGTFRLFER 121 NPT E +AALEGG A A ASG AA V L+ AGSH+VA LYGG+ L + Sbjct: 63 NPTVSVLEERIAALEGGVGAIATASGQAAMHLAVATLMGAGSHIVASGALYGGSHNLLDY 122 Query: 122 VRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLL 181 RR G++ +FV D A++AAIR +T++++ ET NP L ++DI IA +A +HGL Sbjct: 123 TLRRF-GIETTFVPTRDVDAWRAAIRPNTRLLFGETLGNPGLDVLDIPRIAALAHEHGLP 181 Query: 182 TVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDN------------- 228 +VD+TF SP L +P GADLV HSATK+L GH VGG+ V N Sbjct: 182 LLVDSTFTSPYLLKPFEHGADLVFHSATKFLCGHGTAVGGVLVDSGNFDWEASGKFPTLT 241 Query: 229 -----------AELAEQMAFLQNS-------IGGVQGPFDSFLALRGLKTLPLRMRAHCE 270 AE + AFL + G P ++F L+G++TLPLRM+ H E Sbjct: 242 EPYDGFHGMDFAEESTVAAFLLRARREGLRDFGACMSPMNAFQILQGVETLPLRMQRHVE 301 Query: 271 NALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQM-SGFGGIVSIVLKGGFDAAKRFCE 329 NA L +L H A+E V YPGL SHP H LA++ + G G + S +KGG A K+F E Sbjct: 302 NARKLVDFLAAHEAVESVAYPGLESHPDHALAQKLLPRGCGSVFSFSVKGGRPAGKKFIE 361 Query: 330 KTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDL 389 +LF+ ++G +SLV HPA TH + GI +RLSVG+ED DL DL Sbjct: 362 TLKLFSHLANVGDAKSLVIHPASTTHFRMSDEALLAAGIGAGTIRLSVGLEDADDLIEDL 421 Query: 390 ERAL 393 R L Sbjct: 422 SRGL 425 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 433 Length adjustment: 31 Effective length of query: 366 Effective length of database: 402 Effective search space: 147132 Effective search space used: 147132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory