Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate Dsui_0741 Dsui_0741 homoserine O-acetyltransferase
Query= SwissProt::F7XKY8 (492 letters) >FitnessBrowser__PS:Dsui_0741 Length = 375 Score = 381 bits (979), Expect = e-110 Identities = 191/375 (50%), Positives = 263/375 (70%), Gaps = 9/375 (2%) Query: 3 KGSLGIVETKYYHLEEELKLESGRKISDVTIAYEAYGTLNRDKNNVILVCHALTGDAHAA 62 K S+G+V + H E ++L SG ++ + YE YG LN D++N +LVCHAL+G H A Sbjct: 4 KHSVGVVSPQRAHFAEPIQLASGATLAAYDLVYETYGRLNADRSNAVLVCHALSGSHHVA 63 Query: 63 GWHKGDNKP--GWWDILIGPGKCLDTDKYFIVCSNVIGGCRGSTGPSSIDPETGKPYGLS 120 G H DN GWWD L+GPGK LDTDK+F+V N +GGC GSTGP SI+P TGKPYG Sbjct: 64 G-HYADNPKNVGWWDNLVGPGKPLDTDKFFVVGVNNLGGCYGSTGPGSINPATGKPYGAD 122 Query: 121 FPVITIKDMVNAQKKLLDHLGISSIYAVIGGSMGGLQVLQWSVSYPDYINKAIALAASAY 180 FPV+T++D V +Q +L D LGI+ A+IGGS+GG+Q LQWS+ YP+ + A+ +A++ Sbjct: 123 FPVVTVEDWVESQARLADRLGINQWAAIIGGSLGGMQALQWSLEYPERVRHALVIASAPK 182 Query: 181 SSPQQIAFNEVARIAIISDPEWNKGNYY-YSRQPSHGLALARMIGHITYLSDESMREKFG 239 + Q IAFNEVAR AI++DP+++ GNYY + P+ GL LARM+GHITYLSD+ M EKFG Sbjct: 183 LTAQNIAFNEVARQAILTDPDFHGGNYYEHGVVPARGLRLARMVGHITYLSDDQMGEKFG 242 Query: 240 RELQDRD-RYNYDLSMDFQVESYLHYKGRSFTERFDANSYLYITKAVDYFDLTEN--GSL 296 R+L++ +YNYD +DF++ESYL Y+G F FDAN+YL TKA+DYFD + G L Sbjct: 243 RQLREGVLKYNYD--VDFEIESYLRYQGDKFAGFFDANTYLITTKALDYFDPARDFGGDL 300 Query: 297 IDGLKDIKAKCLIIAVTSDWLYPPYQSKDIVMALNANNVDVTYREIESNYGHDAFLLEAG 356 L AK L+++ T+DW + P +S+++V AL NN +V+Y EI+ N GHD+FLL+ Sbjct: 301 KAALARASAKFLLVSFTTDWRFAPERSREMVYALLHNNREVSYAEIDCNAGHDSFLLDDA 360 Query: 357 QLNYVIGGFLNNITV 371 Q + V+G +L+NI V Sbjct: 361 QYHAVMGAYLHNIAV 375 Lambda K H 0.318 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 375 Length adjustment: 32 Effective length of query: 460 Effective length of database: 343 Effective search space: 157780 Effective search space used: 157780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate Dsui_0741 Dsui_0741 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.21676.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-146 472.6 0.0 4.3e-146 472.4 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_0741 Dsui_0741 homoserine O-acetyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0741 Dsui_0741 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.4 0.0 4.3e-146 4.3e-146 3 349 .. 19 369 .. 17 371 .. 0.97 Alignments for each domain: == domain 1 score: 472.4 bits; conditional E-value: 4.3e-146 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgraldtsryfvvc 77 e+++l sG++l ++++y+tyG+lna+r+NavlvcHal+gs+hvag++ ++ k GWWd+l+Gpg++ldt+++fvv+ lcl|FitnessBrowser__PS:Dsui_0741 19 EPIQLASGATLAAYDLVYETYGRLNADRSNAVLVCHALSGSHHVAGHYADNPKnvGWWDNLVGPGKPLDTDKFFVVG 95 7899********************************************9888899********************** PP TIGR01392 78 lNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmqalewalsypervk 154 +N+lG+c+GstgP sinp+tgkpyga+fP+vt++D+v+ q++l+d+Lg++++aa++GgSlGGmqal+w+l+yperv+ lcl|FitnessBrowser__PS:Dsui_0741 96 VNNLGGCYGSTGPGSINPATGKPYGADFPVVTVEDWVESQARLADRLGINQWAAIIGGSLGGMQALQWSLEYPERVR 172 ***************************************************************************** PP TIGR01392 155 kivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmlalltYrseesleerfgreaksee 230 +++v+a++++++aq+iafnev+rqail+Dp++++G+y+e++ P++GL+lARm++++tY+s++++ e+fgr+ ++ lcl|FitnessBrowser__PS:Dsui_0741 173 HALVIASAPKLTAQNIAFNEVARQAILTDPDFHGGNYYEHGvVPARGLRLARMVGHITYLSDDQMGEKFGRQLREG- 248 *****************************************9******************************9999. PP TIGR01392 231 slassleeefsvesylryqgkkfverFdAnsYllltkaldthdlargrrdslkealkkikapvlvvgiesDllftle 307 l+++++ +f++esylryqg+kf+ FdAn+Yl+ tkald++d ar+ ++lk+al++++a++l+v++++D++f++e lcl|FitnessBrowser__PS:Dsui_0741 249 VLKYNYDVDFEIESYLRYQGDKFAGFFDANTYLITTKALDYFDPARDFGGDLKAALARASAKFLLVSFTTDWRFAPE 325 789999*********************************************************************** PP TIGR01392 308 eqeelakalkaakle..yaeieseeGHDaFllekekveeliref 349 +++e++ al +++ e yaei+ ++GHD+Fll+++++++++ ++ lcl|FitnessBrowser__PS:Dsui_0741 326 RSREMVYALLHNNREvsYAEIDCNAGHDSFLLDDAQYHAVMGAY 369 *****999877776668********************9988766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory