Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate Dsui_1570 Dsui_1570 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >FitnessBrowser__PS:Dsui_1570 Length = 448 Score = 413 bits (1062), Expect = e-120 Identities = 222/436 (50%), Positives = 290/436 (66%), Gaps = 8/436 (1%) Query: 4 YVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQ 63 +V W R +PY+N+ R +TFVV G+ + P +D+ LL +LG RLVLVHGSRPQ Sbjct: 12 FVAWFRSVAPYVNAFRGKTFVVAFGGKSISGPLARTFAYDVSLLANLGVRLVLVHGSRPQ 71 Query: 64 IEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRV 123 IE L +GL R+H R+TDA TL+CVIDAVGS+ + +EA LS + +PM G +RV Sbjct: 72 IEEELQEKGLESRFHAGQRITDADTLDCVIDAVGSVYLEVEALLSQGLPNTPMAGNTIRV 131 Query: 124 AGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLA 183 GGN +TARP+GV++GVD +TG VR+ID +G+ L +IVLLS LG SPTGEIFNL+ Sbjct: 132 VGGNFITARPMGVLDGVDLQYTGAVRKIDAEGLKAQLGLGNIVLLSNLGASPTGEIFNLS 191 Query: 184 CEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGNSYQAEL--- 240 E+VA AA L A+KLI QG DA G L+ EL L R+G +L Sbjct: 192 MEEVAEEAAKALGADKLIFLTDSQGATDAEGNLLDEL-TADAAEQLARVGEWLSPDLKRY 250 Query: 241 LDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLI 300 L A +A R GV R HI+ Y DGA+L ELFT G GT+V ++ + LR+A +D+GGL+ Sbjct: 251 LPCAVRASRRGVGRVHIIGYELDGAVLHELFTHDGVGTVVTRDPLDTLRDAKPDDIGGLV 310 Query: 301 ELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIAD----SEAGELACL 356 LI PLEE G LV R RE+LEREI +FS+VE +G+I+ CAALYP A+ ++ ELACL Sbjct: 311 GLIAPLEEDGTLVHRPRELLEREIGRFSVVEHDGVIVGCAALYPYAEDGQKAKTAELACL 370 Query: 357 AVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARA 416 AV+PE+R G G+ L++ IE +A+ G+K LFVLTTRT HWF ERGF +SV+ LP + Sbjct: 371 AVSPEHRRWGYGERLMQHIEGKAKAAGVKRLFVLTTRTTHWFIERGFALASVDELPEEKR 430 Query: 417 SLYNFQRNSQVFEKSL 432 +YN QR S+V KSL Sbjct: 431 HMYNLQRRSKVLMKSL 446 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 448 Length adjustment: 32 Effective length of query: 400 Effective length of database: 416 Effective search space: 166400 Effective search space used: 166400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate Dsui_1570 Dsui_1570 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.15028.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-180 585.9 0.0 2.8e-180 585.7 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_1570 Dsui_1570 amino-acid N-acetyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_1570 Dsui_1570 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 585.7 0.0 2.8e-180 2.8e-180 1 429 [] 12 446 .. 12 446 .. 0.97 Alignments for each domain: == domain 1 score: 585.7 bits; conditional E-value: 2.8e-180 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgrtthyvrG 77 fv+w+r++aPy+na+r+kt+vv++gg+ + ++ ++ d++ll +lGvrlvlvhG+rpqiee+l+++g++++++ G lcl|FitnessBrowser__PS:Dsui_1570 12 FVAWFRSVAPYVNAFRGKTFVVAFGGKSISGPLARTFAYDVSLLANLGVRLVLVHGSRPQIEEELQEKGLESRFHAG 88 8**************************************************************************** PP TIGR01890 78 lrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdyehtGevrkidaegir 154 r+td+ +l++v++a+G++ l++ea ls+ l+ntpmag ++vv Gnf+tarP+Gv++Gvd+++tG vrkidaeg++ lcl|FitnessBrowser__PS:Dsui_1570 89 QRITDADTLDCVIDAVGSVYLEVEALLSQGLPNTPMAGNTIRVVGGNFITARPMGVLDGVDLQYTGAVRKIDAEGLK 165 ***************************************************************************** PP TIGR01890 155 rlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGildadGklvaelsaqeveslverlee 231 +l ++ivlls lg s+tGeifnl+me+va ++a +l+adkli+lt ++G da+G+l el+a+ +e+l+ r++e lcl|FitnessBrowser__PS:Dsui_1570 166 AQLGLGNIVLLSNLGASPTGEIFNLSMEEVAEEAAKALGADKLIFLTDSQGATDAEGNLLDELTADAAEQLA-RVGE 241 ****************************************************************76666554.4554 PP TIGR01890 232 et...tarllsaavkalrgGvarshlvsyaedGallqelftrdGiGtlvskealesireatiddvggilelirPlee 305 +r+l av+a r Gv r+h++ y dGa+l+elft+dG+Gt v+++ l+++r+a+ dd+gg++ li Plee lcl|FitnessBrowser__PS:Dsui_1570 242 WLspdLKRYLPCAVRASRRGVGRVHIIGYELDGAVLHELFTHDGVGTVVTRDPLDTLRDAKPDDIGGLVGLIAPLEE 318 4444469********************************************************************** PP TIGR01890 306 qGilvrrsrellereieefsviekdGliigcaalypyae....eevgelaclavsPeardggrGerllkhiedrarq 378 +G+lv+r rellerei +fsv+e+dG+i+gcaalypyae ++++elaclavsPe r g+Gerl++hie +a++ lcl|FitnessBrowser__PS:Dsui_1570 319 DGTLVHRPRELLEREIGRFSVVEHDGVIVGCAALYPYAEdgqkAKTAELACLAVSPEHRRWGYGERLMQHIEGKAKA 395 *************************************983322478******************************* PP TIGR01890 379 vGlkrlfvlttrtehWfrerGfaeasvdelPearrklynyqrrskilvkkl 429 G+krlfvlttrt+hWf erGfa asvdelPe++r++yn qrrsk+l+k l lcl|FitnessBrowser__PS:Dsui_1570 396 AGVKRLFVLTTRTTHWFIERGFALASVDELPEEKRHMYNLQRRSKVLMKSL 446 ************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (448 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.29 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory