Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate Dsui_0602 Dsui_0602 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >FitnessBrowser__PS:Dsui_0602 Length = 270 Score = 229 bits (585), Expect = 4e-65 Identities = 128/268 (47%), Positives = 168/268 (62%), Gaps = 1/268 (0%) Query: 5 RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64 +I F+G GNMA +LIGGL +G A I + A+ R+K+ + + A D Sbjct: 2 KITFLGGGNMANALIGGLVNKGFAAGDIAVVELNADNRSKLEAAYGVRTFAGAEAAAWDC 61 Query: 65 DVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTPA 124 DV+VL+VKPQ+MK + P LK +QL+VSIAAG+ ASL WLG R +VR MPNTPA Sbjct: 62 DVIVLAVKPQSMKEAIAPIGPHLK-DQLVVSIAAGLNLASLSRWLGGHRRLVRTMPNTPA 120 Query: 125 LLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLLM 184 L+ G +GLYA +V AA A ++L AVG A+W DE+Q+DAVTAVSGSGPAY FL + Sbjct: 121 LIGAGVTGLYALPEVDAAGRAAAQRVLEAVGSAVWFADESQMDAVTAVSGSGPAYVFLFI 180 Query: 185 QAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKSF 244 +A+ AG+ LG E A RL ++T LGAAQ+A S + LR RVTS GTT AA+ Sbjct: 181 EALQQAGKDLGFDDEQARRLAIETVLGAAQLAAQSPDPASVLRERVTSKGGTTAAALAVM 240 Query: 245 QANGFEALVEQALNAASQRSAELAEQLG 272 + G +A + + AA R EL +QLG Sbjct: 241 ETAGVKAGIIAGVKAAEARGVELGQQLG 268 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 270 Length adjustment: 25 Effective length of query: 248 Effective length of database: 245 Effective search space: 60760 Effective search space used: 60760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate Dsui_0602 Dsui_0602 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.11431.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-83 263.8 4.7 1.1e-82 263.6 4.7 1.0 1 lcl|FitnessBrowser__PS:Dsui_0602 Dsui_0602 pyrroline-5-carboxylat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0602 Dsui_0602 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.6 4.7 1.1e-82 1.1e-82 1 263 [] 3 263 .. 3 263 .. 0.98 Alignments for each domain: == domain 1 score: 263.6 bits; conditional E-value: 1.1e-82 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPqdleevla 77 i+++G+Gnm++al+ gl++kg + + +i v+e +++++ +l +++gv++ + ae+a+ + dv++lavKPq ++e++a lcl|FitnessBrowser__PS:Dsui_0602 3 ITFLGGGNMANALIGGLVNKGFA-AGDIAVVELNADNRSKLEAAYGVRTFAGAEAAAWDCDVIVLAVKPQSMKEAIA 78 78*****************9887.8**************************************************** PP TIGR00112 78 elkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellkavGkv 154 + + k++l++Si+AG++++ l+++l++++r+vR mPNt+a +gagvt+++a ev+++ ++ ++++l+avG++ lcl|FitnessBrowser__PS:Dsui_0602 79 PIGP--HLKDQLVVSIAAGLNLASLSRWLGGHRRLVRTMPNTPALIGAGVTGLYALPEVDAAGRAAAQRVLEAVGSA 153 9998..6689******************************************************************* PP TIGR00112 155 veve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkdkVtsPg 230 v+ + e+++davta+sGSgPA+vfl+ieal++ag lG++ e+a++la +t+ Gaa+l ++s + +++L+++Vts+g lcl|FitnessBrowser__PS:Dsui_0602 154 VWFAdESQMDAVTAVSGSGPAYVFLFIEALQQAGKDLGFDDEQARRLAIETVLGAAQLAAQSPDPASVLRERVTSKG 230 **999************************************************************************ PP TIGR00112 231 GtTiaglavLeekgvrsavieaveaavkrseeL 263 GtT+a+lav+e +gv++++i++v+aa +r eL lcl|FitnessBrowser__PS:Dsui_0602 231 GTTAAALAVMETAGVKAGIIAGVKAAEARGVEL 263 **************************9998776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (270 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.83 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory