GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Dechlorosoma suillum PS

Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate Dsui_2134 Dsui_2134 aspartate kinase, monofunctional class

Query= SwissProt::Q88EI9
         (411 letters)



>FitnessBrowser__PS:Dsui_2134
          Length = 407

 Score =  576 bits (1485), Expect = e-169
 Identities = 297/405 (73%), Positives = 348/405 (85%), Gaps = 1/405 (0%)

Query: 1   MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ 60
           MALIVQK+GGTSVGS ERI+ VA++V + +  G D+VVV SAMSGETNRLI LAK+I+  
Sbjct: 1   MALIVQKYGGTSVGSTERIKNVAKRVARWKAMGHDVVVVPSAMSGETNRLIGLAKEISAT 60

Query: 61  PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQK 120
           P PRELDVI STGEQVTI LL MA+ + G+ A SYTG+QVR+LTDS+  KARILQIDD++
Sbjct: 61  PSPRELDVIASTGEQVTIGLLAMAIQEEGLKAKSYTGSQVRVLTDSTFTKARILQIDDER 120

Query: 121 IRADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT 180
           +R DL EG VVVVAGFQG DE+G+ITTLGRGGSDT+ VALAAALKADECQIYTDVDGVYT
Sbjct: 121 MRKDLAEGNVVVVAGFQGADENGNITTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT 180

Query: 181 TDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFK-EGPGTL 239
           TDPRVVP+AR+L+ ITFEEMLEMASLGSKVLQIRSVEFAGKY V LRVL SF+ EG GTL
Sbjct: 181 TDPRVVPEARKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGEGTL 240

Query: 240 ITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVA 299
           IT++++++MEQPIISGIAFNRDEAKLT+ GVPD PG+A++ILGPI+ +NI+VDMI+QNV 
Sbjct: 241 ITVEDDKNMEQPIISGIAFNRDEAKLTVLGVPDRPGIAYQILGPIADANIDVDMIIQNVG 300

Query: 300 HDNTTDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASC 359
            D TTDF+FTV+R+EY KA +VLE   + +GARE++GD K  KVS VGVGMRSH GVAS 
Sbjct: 301 VDGTTDFSFTVNRSEYTKAMAVLEQVKQHVGAREIVGDNKTCKVSAVGVGMRSHPGVASQ 360

Query: 360 MFEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLD 404
           MF  LA+E INIQMISTSEIK+SVV++EKYLELAVR LH  F LD
Sbjct: 361 MFRTLAEEGINIQMISTSEIKISVVIDEKYLELAVRILHKTFGLD 405


Lambda     K      H
   0.316    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 548
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 411
Length of database: 407
Length adjustment: 31
Effective length of query: 380
Effective length of database: 376
Effective search space:   142880
Effective search space used:   142880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate Dsui_2134 Dsui_2134 (aspartate kinase, monofunctional class)
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.8931.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.8931.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.