Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate Dsui_0456 Dsui_0456 homoserine kinase, Neisseria type
Query= SwissProt::P29364 (316 letters) >FitnessBrowser__PS:Dsui_0456 Length = 313 Score = 238 bits (608), Expect = 1e-67 Identities = 142/311 (45%), Positives = 181/311 (58%), Gaps = 9/311 (2%) Query: 1 MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60 MSVFTP+ R L+ +L+ D+G L DF GIA G +N+N+FV+ G +VLTL E + Sbjct: 1 MSVFTPVTREQLKDWLSGCDVGALADFAGIAAGVQNTNYFVTTGRGTWVLTLFETLGAAE 60 Query: 61 LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120 L F++ L+ L GLP P + G LR L GKPA+L RL G+ P HC V Sbjct: 61 LDFYLGLMAHLARQGLPCPAPVADGAGAILRPLAGKPAVLVSRLTGQEVEAPGPAHCAAV 120 Query: 121 GDLLGHLH--AATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDA 178 GD L LH AAT + + P RG W + A + P L ALL LA A Sbjct: 121 GDALARLHLAAATYDGVQDNP--RGEAWRRQAAAQVLPLLSGDDGALLQDELAYQAG--- 175 Query: 179 ERPALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLD 238 ALP +HADLFRDNVLF G L+GL+DFY A +L+DLA+ NDWC + G+L+ Sbjct: 176 PAEALPEGLVHADLFRDNVLFQGERLSGLLDFYFAARDQLLFDLAVAANDWCLDGAGNLE 235 Query: 239 PARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEA-FAGQDVLIHDPAE 297 P R RALL AY RRP A EA WP +LR A +RFWLSRL A AG+ VL+ DP Sbjct: 236 PGRTRALLQAYHRRRPLQAAEARAWPRLLRRAALRFWLSRLQDFHAPRAGRQVLVKDPRH 295 Query: 298 F-EIRLAQRQN 307 F ++ LA+R++ Sbjct: 296 FRDLLLARRRH 306 Lambda K H 0.324 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 313 Length adjustment: 27 Effective length of query: 289 Effective length of database: 286 Effective search space: 82654 Effective search space used: 82654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate Dsui_0456 Dsui_0456 (homoserine kinase, Neisseria type)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.20951.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-108 346.2 0.0 1e-107 346.0 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_0456 Dsui_0456 homoserine kinase, Nei Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0456 Dsui_0456 homoserine kinase, Neisseria type # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 346.0 0.0 1e-107 1e-107 1 305 [. 1 300 [. 1 302 [. 0.98 Alignments for each domain: == domain 1 score: 346.0 bits; conditional E-value: 1e-107 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflellthLaergl 77 m+v+t v+ e+l+ +L+g d+G+l ++ Gia Gv+n+ny++tt +g +vLtl+e a eL f+l l+ hLa +gl lcl|FitnessBrowser__PS:Dsui_0456 1 MSVFTPVTREQLKDWLSGCDVGALADFAGIAAGVQNTNYFVTTGRGTWVLTLFETLG-AAELDFYLGLMAHLARQGL 76 9*******************************************************9.99***************** PP TIGR00938 78 pvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkeerkndlrleaWsilaak 154 p+++pv+ +G+ l LaGkPa+lv+ L+G++v+ P +++c++vg+ la+lhla+a +++ ++n +r eaW+ +aa+ lcl|FitnessBrowser__PS:Dsui_0456 77 PCPAPVADGAGAILRPLAGKPAVLVSRLTGQEVEAPGPAHCAAVGDALARLHLAAATYDGVQDN-PRGEAWRRQAAA 152 ****************************************************************.************ PP TIGR00938 155 kfkvleqleeelaalldkeldalkkflprdLPrgvihadlfkdnvlldgdklkgvidfyfaCedallydlaiavndW 231 + vl+ l+ +++all++el++ ++ LP+g++hadlf+dnvl++g++l+g++dfyfa +d+ll+dla+a ndW lcl|FitnessBrowser__PS:Dsui_0456 153 Q--VLPLLSGDDGALLQDELAYQA-GPAEALPEGLVHADLFRDNVLFQGERLSGLLDFYFAARDQLLFDLAVAANDW 226 9..*****************9976.56789*********************************************** PP TIGR00938 232 cfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqagelvvakdPaeferkL 305 c++ ++l+ +++all++y+++rpL + e a+p llr aalrf+lsrl+d++ ++ag v +kdP++f+ +L lcl|FitnessBrowser__PS:Dsui_0456 227 CLDGAGNLEPGRTRALLQAYHRRRPLQAAEARAWPRLLRRAALRFWLSRLQDFHAPRAGRQVLVKDPRHFRDLL 300 **********************************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory