Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate Dsui_3192 Dsui_3192 tryptophan synthase, beta subunit
Query= uniprot:P50383 (425 letters) >FitnessBrowser__PS:Dsui_3192 Length = 398 Score = 132 bits (333), Expect = 1e-35 Identities = 111/361 (30%), Positives = 165/361 (45%), Gaps = 50/361 (13%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+P++ AKR E L A+IY K E TG+HK+N I QA AK G V+ ET Sbjct: 56 VGRPSPIYHAKRWSELLGG-AQIYLKREDLNHTGAHKVNNCIGQALLAKRMGKPRVIAET 114 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAGQ G A A A+ Y + ++M +++ M+L GA V E G K Sbjct: 115 GAGQHGVATATVAARYGFECVVYMGSEDVKRQAANVYRMKLLGATVVP-----VESGSKT 169 Query: 192 LETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLD------VVLLHQSVIGQETITQL- 244 L+ +L AM + + ++N F Y++G+V +V Q+VIG+E + Q+ Sbjct: 170 LK------DALNEAMRDWVT-NIENTF-YIIGTVAGPHPYPMMVRDFQTVIGKEALVQMP 221 Query: 245 DLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGK--------------RYIAVSSAEIPK 290 ++ G D +I VGGGSN G +P+I ++ K R+ A P Sbjct: 222 EMAGRQPDAVIAAVGGGSNAMGIFHPYIPHESVKLIGVEAAGEGMDTNRHSASLQKGRPG 281 Query: 291 FSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWR 350 G Y D G + I+ G D Y GV P + L G E+ Sbjct: 282 VLHGNRTYLLQDENGQITETHSISAGLD------------YPGVGPEHAWLKDSGRAEYV 329 Query: 351 EYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLD 410 ++ E +A +GI+PA ES+HA+ A K+ K+++ NLSG G D Sbjct: 330 GISDSEALQAFHDLCRFEGIIPALESSHALAYAAKLAPSLAKD---KILLVNLSGRGDKD 386 Query: 411 L 411 + Sbjct: 387 M 387 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 398 Length adjustment: 31 Effective length of query: 394 Effective length of database: 367 Effective search space: 144598 Effective search space used: 144598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Dsui_3192 Dsui_3192 (tryptophan synthase, beta subunit)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.16064.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-196 639.0 0.1 1.6e-196 638.8 0.1 1.0 1 lcl|FitnessBrowser__PS:Dsui_3192 Dsui_3192 tryptophan synthase, b Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_3192 Dsui_3192 tryptophan synthase, beta subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 638.8 0.1 1.6e-196 1.6e-196 1 384 [. 10 393 .. 10 394 .. 1.00 Alignments for each domain: == domain 1 score: 638.8 bits; conditional E-value: 1.6e-196 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredllh 77 g+fg +GG +v+e+l++aleel++ay +a +d++f++e+++ lk+y+grp+p+++ak+ s+ lgga+iylkredl+h lcl|FitnessBrowser__PS:Dsui_3192 10 GHFGPYGGIFVSETLIAALEELKAAYAHACTDPAFQAEFDYELKHYVGRPSPIYHAKRWSELLGGAQIYLKREDLNH 86 68*************************************************************************** PP TIGR00263 78 tGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgakvvpv 154 tGahk+nn +gqallakr+Gk r+iaetGaGqhGvatat+aa+ g+ec+vymG+edv+rq+ nv+rm+llga+vvpv lcl|FitnessBrowser__PS:Dsui_3192 87 TGAHKVNNCIGQALLAKRMGKPRVIAETGAGQHGVATATVAARYGFECVVYMGSEDVKRQAANVYRMKLLGATVVPV 163 ***************************************************************************** PP TIGR00263 155 tsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviacvGGGsn 231 +sGsktlkda+nea+rdWvt++e+t+y++G+++GphP+P +vr+fq+vig+e+ q+ e++gr Pdavia+vGGGsn lcl|FitnessBrowser__PS:Dsui_3192 164 ESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQTVIGKEALVQMPEMAGRQPDAVIAAVGGGSN 240 ***************************************************************************** PP TIGR00263 232 aiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgvgPeh 308 a+Gif+++i +e+v+ligvea+G+G+dt++h+a+l+kG++GvlhG++t+llqde+Gqi+e+hs+saGldypgvgPeh lcl|FitnessBrowser__PS:Dsui_3192 241 AMGIFHPYIPHESVKLIGVEAAGEGMDTNRHSASLQKGRPGVLHGNRTYLLQDENGQITETHSISAGLDYPGVGPEH 317 ***************************************************************************** PP TIGR00263 309 aalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGdkdletvaka 384 a+l+++graey+ i+d+eal+a++ l++ eGiipalesshala++ klap+l+kd+i++vnlsGrGdkd++tva++ lcl|FitnessBrowser__PS:Dsui_3192 318 AWLKDSGRAEYVGISDSEALQAFHDLCRFEGIIPALESSHALAYAAKLAPSLAKDKILLVNLSGRGDKDMHTVAEK 393 *************************************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (398 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.10 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory