Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate Dsui_0169 Dsui_0169 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__PS:Dsui_0169 Length = 340 Score = 428 bits (1100), Expect = e-124 Identities = 216/339 (63%), Positives = 266/339 (78%) Query: 3 ITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAAT 62 ++PQ+AL R IEHREIFHDEM++LMRQIM GE+S M++AI T LRVKKETIGEIA AA Sbjct: 1 MSPQEALTRCIEHREIFHDEMLELMRQIMSGEMSPVMIAAITTALRVKKETIGEIAAAAQ 60 Query: 63 VMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKS 122 VMREF+ +V V D +VDIVGTGGDG+HTFN+ST +MFV AA GAKVAKHG RSVSSKS Sbjct: 61 VMREFATKVPVRDPSAVVDIVGTGGDGAHTFNVSTSSMFVCAAAGAKVAKHGGRSVSSKS 120 Query: 123 GSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNIL 182 GSAD LEALG + L PE++A + GIGFM+AP HH AMK APVRRE+GVRTIFNIL Sbjct: 121 GSADVLEALGVNLNLPPERIAECIDTVGIGFMFAPNHHGAMKHAAPVRRELGVRTIFNIL 180 Query: 183 GPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGEL 242 GPLTNPAG+ ++GVFH DLVGI RVLQ LG++RA V+G DG+DE+S TL+GEL Sbjct: 181 GPLTNPAGAERQVLGVFHADLVGILIRVLQRLGSQRAFTVFGVDGLDEISNSGRTLIGEL 240 Query: 243 RDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGAAL 302 +DG++HEYE+HPEDF + + R ++V + ES+ M+L L+ GPA DIVALNAGA+L Sbjct: 241 KDGRIHEYEIHPEDFNLPVHDPRVIRVGNVEESKTMVLAALEGRHGPARDIVALNAGASL 300 Query: 303 YVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQA 341 YVAG+ADS+A G+ +A +A G+ARA LD +V FT+ A Sbjct: 301 YVAGLADSMAQGVEKALDAIACGAARAKLDEFVRFTEVA 339 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 340 Length adjustment: 29 Effective length of query: 316 Effective length of database: 311 Effective search space: 98276 Effective search space used: 98276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Dsui_0169 Dsui_0169 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.8209.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-132 425.4 0.3 9.5e-132 425.2 0.3 1.0 1 lcl|FitnessBrowser__PS:Dsui_0169 Dsui_0169 anthranilate phosphori Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0169 Dsui_0169 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 425.2 0.3 9.5e-132 9.5e-132 2 329 .. 8 334 .. 7 335 .. 0.99 Alignments for each domain: == domain 1 score: 425.2 bits; conditional E-value: 9.5e-132 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivGTG 78 ++++++++ ++e+ +lm++imsge+s++ iaAi +alrvk et+ eia++a+++re a+kv++++ + +vDivGTG lcl|FitnessBrowser__PS:Dsui_0169 8 TRCIEHREIFHDEMLELMRQIMSGEMSPVMIAAITTALRVKKETIGEIAAAAQVMREFATKVPVRDPSAVVDIVGTG 84 6899************************************************************************* PP TIGR01245 79 GDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhpal 155 GDg++t+N+ST s++v aaaG+kvaKhG rsvssksGsaDvLealgvnl+l pe++a+++++vgigF+fAP++h a+ lcl|FitnessBrowser__PS:Dsui_0169 85 GDGAHTFNVSTSSMFVCAAAGAKVAKHGGRSVSSKSGSADVLEALGVNLNLPPERIAECIDTVGIGFMFAPNHHGAM 161 ***************************************************************************** PP TIGR01245 156 kevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkva 232 k++apvR+eLgvrt+fN+LGPL+nPa a++qvlGv+++dlv +l++vl++lg++ra+ v g dglDEis g+t + lcl|FitnessBrowser__PS:Dsui_0169 162 KHAAPVRRELGVRTIFNILGPLTNPAGAERQVLGVFHADLVGILIRVLQRLGSQRAFTVFGVDGLDEISNSGRTLIG 238 ***************************************************************************** PP TIGR01245 233 elkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegve 309 elkdg+i+ey+++pedf l+ ++ + +++g+ ee+ +++ ++leg++ +++rdiv+lNa+a lyvag a+++++gve lcl|FitnessBrowser__PS:Dsui_0169 239 ELKDGRIHEYEIHPEDFNLPVHDPRVIRVGNVEESKTMVLAALEGRH-GPARDIVALNAGASLYVAGLADSMAQGVE 314 **********************************************9.999************************** PP TIGR01245 310 lakeaiksgkalekleelva 329 a++ai g+a +kl+e+v+ lcl|FitnessBrowser__PS:Dsui_0169 315 KALDAIACGAARAKLDEFVR 334 *****************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory