Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate 5210610 Shew_3038 asparagine synthase (glutamine-hydrolyzing) (RefSeq)
Query= CharProtDB::CH_007942 (614 letters) >FitnessBrowser__PV4:5210610 Length = 590 Score = 252 bits (644), Expect = 3e-71 Identities = 176/554 (31%), Positives = 273/554 (49%), Gaps = 56/554 (10%) Query: 1 MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDI-EGG 59 MCGI G + F ++ + M D L+ RGPD ++ GH+RL ++D+ E G Sbjct: 1 MCGIAGELSFTTSAKVDQ--VAAMLDKLAPRGPDGQGLYSLGPCCLGHRRLKIIDLSEHG 58 Query: 60 RQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVD 119 QPM G T+++NG +YN LR EL G+ F SD+EV+L +Y W CV+ Sbjct: 59 AQPMVDAELG--LTLVFNGCIYNYRALRAELSELGYHFFSHSDSEVILKAYAHWGRQCVE 116 Query: 120 HLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDR 179 NG+FAFA+ + LF ARDRLG+KP +Y K+G S +F S + A+L HP +D Sbjct: 117 KFNGMFAFAIHERDTGRLFIARDRLGIKPLYYFKDGHSLVFASSLPALLRHPVADTEIDP 176 Query: 180 TGLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDG-LNIWRYWNVE--SEKHTDSFD 236 L+ T +FK I ++ AH + DG ++ YW++ S T++ + Sbjct: 177 QSLNHYLCFRAIVGDKT-LFKQIHKLEAAHWMLVRPDGQVDHQSYWHLSPGSSLETETEE 235 Query: 237 DTVANVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDY 296 + D+ R+L +DVPV LSGGLDSS I G + G+ +HT+SI + Sbjct: 236 TWSQQLEQKLFDSAKRRLEADVPVGVLLSGGLDSSLI----VGLLHELGQKEIHTFSIGF 291 Query: 297 EENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMAD 356 ++ A + ++ + + + E + T H K V+S +L+ HL + V+ P ++ Sbjct: 292 DD-------VADEQGNEFKYSDLIAEHYQTRHQKIVVSHSELISHLPDCVMAMSEPMVSH 344 Query: 357 VDSSLLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRST-EERIKLLSD 415 + + + V SG+ ADE+FGGY W+ P + +T E+ + D Sbjct: 345 DVIGFYLLSKTVSQHVKVVQSGQGADEVFGGYHWYP--------PMVDATAEDEAQTYQD 396 Query: 416 ---SWQKKLNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLN---------MLWFM 463 SWQ +Y++ +AE PLLDG+ D RR + ML Sbjct: 397 AYFSWQ---------YPEYQQLVAE-PLLDGDHAGDYVRRYFAHCPAETAIDKTLMLDTR 446 Query: 464 TNLLD----RKDRMSMGASLEVRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGI 519 L+D R D M+M LE RVPF DH LVE IP+++K+ + K +L++ I Sbjct: 447 VMLVDDPVKRVDNMTMAFGLEARVPFLDHELVELASRIPFDLKLKEG-GKYLLKQVARRI 505 Query: 520 LPDDILYRKKSPYP 533 +P ++ R K +P Sbjct: 506 IPHQVIDRPKGYFP 519 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 912 Number of extensions: 49 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 614 Length of database: 590 Length adjustment: 37 Effective length of query: 577 Effective length of database: 553 Effective search space: 319081 Effective search space used: 319081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate 5210610 Shew_3038 (asparagine synthase (glutamine-hydrolyzing) (RefSeq))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.6410.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-141 458.0 0.0 3.2e-141 457.8 0.0 1.0 1 lcl|FitnessBrowser__PV4:5210610 Shew_3038 asparagine synthase (g Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210610 Shew_3038 asparagine synthase (glutamine-hydrolyzing) (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.8 0.0 3.2e-141 3.2e-141 1 516 [. 2 517 .. 2 518 .. 0.90 Alignments for each domain: == domain 1 score: 457.8 bits; conditional E-value: 3.2e-141 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsnek.evvivfn 76 Cgiag + ++ ak +++++ml++la RGPD++g+++ ++lghrRL iidlse aQP+ +++ ++vfn lcl|FitnessBrowser__PV4:5210610 2 CGIAGELSFTTSAKV--DQVAAMLDKLAPRGPDGQGLYSL---GPCCLGHRRLKIIDLSEHgAQPMVDAElGLTLVFN 74 *********997776..79******************999...8***************998*********99***** PP TIGR01536 77 GEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelflaRDrlGikPLYyaseq 154 G IYN+++Lr+el e Gy+F ++sD+EViL+ay +wg+++ve+++GmFAfa++++ +g+lf+aRDrlGikPLYy +++ lcl|FitnessBrowser__PV4:5210610 75 GCIYNYRALRAELSELGYHFFSHSDSEVILKAYAHWGRQCVEKFNGMFAFAIHERDTGRLFIARDRLGIKPLYYFKDG 152 ****************************************************************************** PP TIGR01536 155 gkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepakal....dgeekleeywevekee..v 226 +l+faS + all+++ +++e+d + l ++l + + +ktlfk++++le+a+ + dg+ + ++yw+++ + lcl|FitnessBrowser__PV4:5210610 153 HSLVFASSLPALLRHPVADTEIDPQSLNHYLCFRAIVGDKTLFKQIHKLEAAHWMlvrpDGQVDHQSYWHLSPGSslE 230 **********************************889****************99997766666677**999777668 PP TIGR01536 227 keseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeaksevktFsigfe..dskdldeskaarkv 302 +e+ee+ ++l+++l d+ k+rl advpvgvllSGGlDSsl++ ++++ ++e++tFsigf+ +++ +e k+ + lcl|FitnessBrowser__PV4:5210610 231 TETEETWSQQLEQKLFDSAKRRLEADVPVGVLLSGGLDSSLIVGLLHELGQKEIHTFSIGFDdvADEQGNEFKYSDLI 308 8999999******************************************************955567778889***** PP TIGR01536 303 adelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakae 380 a++ t+h+++++s+ e++++l++ ++a+ ep+ +++i+ yllsk ++++ vkVv sG+GaDE+fgGY+++ + + lcl|FitnessBrowser__PV4:5210610 309 AEHYQTRHQKIVVSHSELISHLPDCVMAMSEPMVSHDVIGFYLLSKTVSQH-VKVVQSGQGADEVFGGYHWYPPMVDA 385 ***************************************************.********************986443 PP TIGR01536 381 ealelpeaselaekklllqaklakeselkellkakleeelkekeelkkelkeeseleellrldlelllsdl.lrakDr 457 a ++ +++ + ++ + ++l + +++ ++++ +++ ++e++++++l ld+ +l d+ +++ D lcl|FitnessBrowser__PV4:5210610 386 TAEDEAQ----TYQDAYFSWQYPEYQQLVAEPLLDGDHAGDYVRRYFAHCPAETAIDKTLMLDTRVMLVDDpVKRVDN 459 3333122....222222222222222222223334555666778888899999**********9998877626666** PP TIGR01536 458 vsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPeeileRkKea 516 ++ma +lE+RvPflD+elvela +ip +lkl++g K+lL+++a++++P+++ +R+K lcl|FitnessBrowser__PV4:5210610 460 MTMAFGLEARVPFLDHELVELASRIPFDLKLKEG-GKYLLKQVARRIIPHQVIDRPKGY 517 *******************************987.7********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (590 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 13.36 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory