Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate 5210610 Shew_3038 asparagine synthase (glutamine-hydrolyzing) (RefSeq)
Query= CharProtDB::CH_007942 (614 letters) >lcl|FitnessBrowser__PV4:5210610 Shew_3038 asparagine synthase (glutamine-hydrolyzing) (RefSeq) Length = 590 Score = 252 bits (644), Expect = 3e-71 Identities = 176/554 (31%), Positives = 273/554 (49%), Gaps = 56/554 (10%) Query: 1 MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDI-EGG 59 MCGI G + F ++ + M D L+ RGPD ++ GH+RL ++D+ E G Sbjct: 1 MCGIAGELSFTTSAKVDQ--VAAMLDKLAPRGPDGQGLYSLGPCCLGHRRLKIIDLSEHG 58 Query: 60 RQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVD 119 QPM G T+++NG +YN LR EL G+ F SD+EV+L +Y W CV+ Sbjct: 59 AQPMVDAELG--LTLVFNGCIYNYRALRAELSELGYHFFSHSDSEVILKAYAHWGRQCVE 116 Query: 120 HLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDR 179 NG+FAFA+ + LF ARDRLG+KP +Y K+G S +F S + A+L HP +D Sbjct: 117 KFNGMFAFAIHERDTGRLFIARDRLGIKPLYYFKDGHSLVFASSLPALLRHPVADTEIDP 176 Query: 180 TGLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDG-LNIWRYWNVE--SEKHTDSFD 236 L+ T +FK I ++ AH + DG ++ YW++ S T++ + Sbjct: 177 QSLNHYLCFRAIVGDKT-LFKQIHKLEAAHWMLVRPDGQVDHQSYWHLSPGSSLETETEE 235 Query: 237 DTVANVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDY 296 + D+ R+L +DVPV LSGGLDSS I G + G+ +HT+SI + Sbjct: 236 TWSQQLEQKLFDSAKRRLEADVPVGVLLSGGLDSSLI----VGLLHELGQKEIHTFSIGF 291 Query: 297 EENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMAD 356 ++ A + ++ + + + E + T H K V+S +L+ HL + V+ P ++ Sbjct: 292 DD-------VADEQGNEFKYSDLIAEHYQTRHQKIVVSHSELISHLPDCVMAMSEPMVSH 344 Query: 357 VDSSLLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRST-EERIKLLSD 415 + + + V SG+ ADE+FGGY W+ P + +T E+ + D Sbjct: 345 DVIGFYLLSKTVSQHVKVVQSGQGADEVFGGYHWYP--------PMVDATAEDEAQTYQD 396 Query: 416 ---SWQKKLNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLN---------MLWFM 463 SWQ +Y++ +AE PLLDG+ D RR + ML Sbjct: 397 AYFSWQ---------YPEYQQLVAE-PLLDGDHAGDYVRRYFAHCPAETAIDKTLMLDTR 446 Query: 464 TNLLD----RKDRMSMGASLEVRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGI 519 L+D R D M+M LE RVPF DH LVE IP+++K+ + K +L++ I Sbjct: 447 VMLVDDPVKRVDNMTMAFGLEARVPFLDHELVELASRIPFDLKLKEG-GKYLLKQVARRI 505 Query: 520 LPDDILYRKKSPYP 533 +P ++ R K +P Sbjct: 506 IPHQVIDRPKGYFP 519 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 912 Number of extensions: 49 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 614 Length of database: 590 Length adjustment: 37 Effective length of query: 577 Effective length of database: 553 Effective search space: 319081 Effective search space used: 319081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate 5210610 Shew_3038 (asparagine synthase (glutamine-hydrolyzing) (RefSeq))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.32347.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-141 458.0 0.0 3.2e-141 457.8 0.0 1.0 1 lcl|FitnessBrowser__PV4:5210610 Shew_3038 asparagine synthase (g Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210610 Shew_3038 asparagine synthase (glutamine-hydrolyzing) (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.8 0.0 3.2e-141 3.2e-141 1 516 [. 2 517 .. 2 518 .. 0.90 Alignments for each domain: == domain 1 score: 457.8 bits; conditional E-value: 3.2e-141 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsnek.evvivfn 76 Cgiag + ++ ak +++++ml++la RGPD++g+++ ++lghrRL iidlse aQP+ +++ ++vfn lcl|FitnessBrowser__PV4:5210610 2 CGIAGELSFTTSAKV--DQVAAMLDKLAPRGPDGQGLYSL---GPCCLGHRRLKIIDLSEHgAQPMVDAElGLTLVFN 74 *********997776..79******************999...8***************998*********99***** PP TIGR01536 77 GEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelflaRDrlGikPLYyaseq 154 G IYN+++Lr+el e Gy+F ++sD+EViL+ay +wg+++ve+++GmFAfa++++ +g+lf+aRDrlGikPLYy +++ lcl|FitnessBrowser__PV4:5210610 75 GCIYNYRALRAELSELGYHFFSHSDSEVILKAYAHWGRQCVEKFNGMFAFAIHERDTGRLFIARDRLGIKPLYYFKDG 152 ****************************************************************************** PP TIGR01536 155 gkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepakal....dgeekleeywevekee..v 226 +l+faS + all+++ +++e+d + l ++l + + +ktlfk++++le+a+ + dg+ + ++yw+++ + lcl|FitnessBrowser__PV4:5210610 153 HSLVFASSLPALLRHPVADTEIDPQSLNHYLCFRAIVGDKTLFKQIHKLEAAHWMlvrpDGQVDHQSYWHLSPGSslE 230 **********************************889****************99997766666677**999777668 PP TIGR01536 227 keseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeaksevktFsigfe..dskdldeskaarkv 302 +e+ee+ ++l+++l d+ k+rl advpvgvllSGGlDSsl++ ++++ ++e++tFsigf+ +++ +e k+ + lcl|FitnessBrowser__PV4:5210610 231 TETEETWSQQLEQKLFDSAKRRLEADVPVGVLLSGGLDSSLIVGLLHELGQKEIHTFSIGFDdvADEQGNEFKYSDLI 308 8999999******************************************************955567778889***** PP TIGR01536 303 adelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakae 380 a++ t+h+++++s+ e++++l++ ++a+ ep+ +++i+ yllsk ++++ vkVv sG+GaDE+fgGY+++ + + lcl|FitnessBrowser__PV4:5210610 309 AEHYQTRHQKIVVSHSELISHLPDCVMAMSEPMVSHDVIGFYLLSKTVSQH-VKVVQSGQGADEVFGGYHWYPPMVDA 385 ***************************************************.********************986443 PP TIGR01536 381 ealelpeaselaekklllqaklakeselkellkakleeelkekeelkkelkeeseleellrldlelllsdl.lrakDr 457 a ++ +++ + ++ + ++l + +++ ++++ +++ ++e++++++l ld+ +l d+ +++ D lcl|FitnessBrowser__PV4:5210610 386 TAEDEAQ----TYQDAYFSWQYPEYQQLVAEPLLDGDHAGDYVRRYFAHCPAETAIDKTLMLDTRVMLVDDpVKRVDN 459 3333122....222222222222222222223334555666778888899999**********9998877626666** PP TIGR01536 458 vsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPeeileRkKea 516 ++ma +lE+RvPflD+elvela +ip +lkl++g K+lL+++a++++P+++ +R+K lcl|FitnessBrowser__PV4:5210610 460 MTMAFGLEARVPFLDHELVELASRIPFDLKLKEG-GKYLLKQVARRIIPHQVIDRPKGY 517 *******************************987.7********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (590 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.91 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory