Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate 5209968 Shew_2416 chorismate synthase (RefSeq)
Query= SwissProt::P12008 (361 letters) >lcl|FitnessBrowser__PV4:5209968 Shew_2416 chorismate synthase (RefSeq) Length = 364 Score = 552 bits (1422), Expect = e-162 Identities = 275/359 (76%), Positives = 311/359 (86%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GN+IGQ F VTTFGESHG ALGCI+DG PPG+ + EAD+QHDLDRRRPGTSRYTT RR Sbjct: 1 MSGNSIGQNFVVTTFGESHGKALGCIIDGCPPGLAIDEADMQHDLDRRRPGTSRYTTARR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPDQVKILSGVFEG TTGTSIGL+IENTDQRSQDYS IKD FRPGHADYTY+QKYGLRDY Sbjct: 61 EPDQVKILSGVFEGQTTGTSIGLVIENTDQRSQDYSNIKDQFRPGHADYTYQQKYGLRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARETAMRVAAGA+AKKYL + GIEI+G L+Q+G I +I D+ QVE N FF Sbjct: 121 RGGGRSSARETAMRVAAGAVAKKYLKQVHGIEIKGYLSQLGPICAEILDFDQVEHNAFFF 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 PD K++ LDE MR LKK GDSIGAKV+VVA+ VP GLGEPVFDRLDADIAHALM INAV Sbjct: 181 PDAAKLEQLDEYMRELKKSGDSIGAKVSVVATNVPVGLGEPVFDRLDADIAHALMGINAV 240 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIGDGF VV +GS++RD ++ +GF SNHAGGILGGISSGQ I+AH+A+KPTSSI+V Sbjct: 241 KGVEIGDGFAVVNQKGSEHRDLMSPEGFASNHAGGILGGISSGQPIVAHIAMKPTSSISV 300 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIP 359 PG ++ GE E++TKGRHDPCVGIRAVPIAEAMLAIVLMDHLLR RAQN +V++ P Sbjct: 301 PGESMTVQGERAEVVTKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQNMNVESITP 359 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 364 Length adjustment: 29 Effective length of query: 332 Effective length of database: 335 Effective search space: 111220 Effective search space used: 111220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 5209968 Shew_2416 (chorismate synthase (RefSeq))
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.3052.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-145 469.6 0.5 3.2e-145 469.5 0.5 1.0 1 lcl|FitnessBrowser__PV4:5209968 Shew_2416 chorismate synthase (R Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209968 Shew_2416 chorismate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.5 0.5 3.2e-145 3.2e-145 1 350 [. 10 350 .. 10 351 .. 0.97 Alignments for each domain: == domain 1 score: 469.5 bits; conditional E-value: 3.2e-145 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPiallikN 78 + +ttfGeSHgkalg+iidG+P+gl ++e+d+q++l+rRrpg+sr+t+ r+E D+v+ilsGvfeG+TtG+ i l+i+N lcl|FitnessBrowser__PV4:5209968 10 FVVTTFGESHGKALGCIIDGCPPGLAIDEADMQHDLDRRRPGTSRYTTARREPDQVKILSGVFEGQTTGTSIGLVIEN 87 569*************************************************************************** PP TIGR00033 79 kdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvklgevel 156 +d+rs+dy++ik+++RPgHadyty++KYg++d++gggrsSaReTa+rvaaGavakk+Lk+ +giei++y+++lg +++ lcl|FitnessBrowser__PV4:5209968 88 TDQRSQDYSNIKDQFRPGHADYTYQQKYGLRDYRGGGRSSARETAMRVAAGAVAKKYLKQVHGIEIKGYLSQLGPICA 165 *****************************************************************************9 PP TIGR00033 157 eeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaelasallsin 234 e ++ +++++ +++pda + +++ e++ ++kk+gds+G++v+vv++nvpvglGep+fd+lda +a+al++in lcl|FitnessBrowser__PV4:5209968 166 EILDFD-----QVEHNAFFFPDAAKLEQLDEYMRELKKSGDSIGAKVSVVATNVPVGLGEPVFDRLDADIAHALMGIN 238 965544.....69999************************************************************** PP TIGR00033 235 AvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkek 312 AvKgveiGdGF+ ++++Gse+ D + + + +n+ GGi+GGi+ G++i+ +ia+Kp+++i+ p ++++++++ + lcl|FitnessBrowser__PV4:5209968 239 AVKGVEIGDGFAVVNQKGSEHRDLMS--PE--GFASNHAGGILGGISSGQPIVAHIAMKPTSSISVPGESMTVQGERA 312 ***********************554..33..589**************************************99999 PP TIGR00033 313 akatkgRhDpcvvpravpvvEamvalvladallekras 350 +tkgRhDpcv +ravp++Eam+a+vl+d+ll++ra+ lcl|FitnessBrowser__PV4:5209968 313 EVVTKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQ 350 9999*******************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory