Align imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase (EC 4.2.1.19; EC 3.1.3.15) (characterized)
to candidate 5209747 Shew_2200 imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq)
Query= ecocyc::IMIDPHOSPHADEHYDHISTIDPHOSPHA-MONOMER (355 letters) >lcl|FitnessBrowser__PV4:5209747 Shew_2200 imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq) Length = 356 Score = 476 bits (1225), Expect = e-139 Identities = 233/355 (65%), Positives = 279/355 (78%) Query: 1 MSQKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPELLKLQKAGYKLVMITNQDGLG 60 M QK LFIDRDGTLI EP +D QVD KL FEP VIP LLKLQ AGY+LVM++NQDGLG Sbjct: 2 MKQKILFIDRDGTLIEEPVTDKQVDSLAKLVFEPQVIPALLKLQGAGYRLVMVSNQDGLG 61 Query: 61 TQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAM 120 T SFP+ DFD P N+MMQIF SQGV+FD+VLICPH + C CRKPK+ LV+ YL E + Sbjct: 62 TPSFPKDDFDAPQNMMMQIFNSQGVKFDDVLICPHFDDENCSCRKPKLGLVKAYLTEGRV 121 Query: 121 DRANSYVIGDRATDIQLAENMGITGLRYDRETLNWPMIGEQLTRRDRYAHVVRNTKETQI 180 D S VIGDR TD+ LAE MGITG++Y+R+TLNW I EQL +R A VVR TKET I Sbjct: 122 DFTQSAVIGDRETDLGLAEAMGITGIQYNRDTLNWDAIAEQLLGGNRVATVVRTTKETDI 181 Query: 181 DVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALG 240 V V LD + S INTG+GFFDHMLDQIATHG FR++++V GDL IDDHH+VEDT LA+G Sbjct: 182 KVTVDLDSQLKSSINTGIGFFDHMLDQIATHGNFRLDVSVDGDLEIDDHHSVEDTALAIG 241 Query: 241 EALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEH 300 +AL+ ALGDKRGI RFGF +PMDE A C LD+SGRP ++++ +F + VG+++TEM+ H Sbjct: 242 DALRQALGDKRGIARFGFSIPMDEASASCLLDLSGRPFIKFEGQFEREMVGEMATEMVPH 301 Query: 301 FFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDTLPSSKGVL 355 FFRSL+ + TLHL T+G NDHH+VESLFK FGRTLRQA++VEGD LPSSKGVL Sbjct: 302 FFRSLADGLRCTLHLSTQGDNDHHKVESLFKVFGRTLRQAVKVEGDALPSSKGVL 356 Lambda K H 0.322 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 356 Length adjustment: 29 Effective length of query: 326 Effective length of database: 327 Effective search space: 106602 Effective search space used: 106602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate 5209747 Shew_2200 (imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq))
to HMM TIGR01261 (hisB: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01261.hmm # target sequence database: /tmp/gapView.10266.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01261 [M=161] Accession: TIGR01261 Description: hisB_Nterm: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-81 255.3 0.0 1.2e-80 254.7 0.0 1.2 1 lcl|FitnessBrowser__PV4:5209747 Shew_2200 imidazole glycerol-pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209747 Shew_2200 imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 254.7 0.0 1.2e-80 1.2e-80 1 160 [. 4 163 .. 4 164 .. 0.99 Alignments for each domain: == domain 1 score: 254.7 bits; conditional E-value: 1.2e-80 TIGR01261 1 qkilfidrdGtlieePksdfqvdaleklklekkvipallklkeagyklvlvtnqdGlGtesfPkedfdkphalmlqif 78 qkilfidrdGtlieeP +d qvd+l kl +e++vipallkl+ agy+lv+v+nqdGlGt+sfPk+dfd p+++m+qif lcl|FitnessBrowser__PV4:5209747 4 QKILFIDRDGTLIEEPVTDKQVDSLAKLVFEPQVIPALLKLQGAGYRLVMVSNQDGLGTPSFPKDDFDAPQNMMMQIF 81 79**************************************************************************** PP TIGR01261 79 kseGivfddvlicphfledncacrkPkiklleeylkkekidkersyviGdretdlqlaenlgirglkykeeelnwkei 156 +s+G++fddvlicphf ++nc+crkPk++l+++yl + ++d +s+viGdretdl lae +gi+g++y++++lnw+ i lcl|FitnessBrowser__PV4:5209747 82 NSQGVKFDDVLICPHFDDENCSCRKPKLGLVKAYLTEGRVDFTQSAVIGDRETDLGLAEAMGITGIQYNRDTLNWDAI 159 ****************************************************************************** PP TIGR01261 157 akel 160 a++l lcl|FitnessBrowser__PV4:5209747 160 AEQL 163 *998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (161 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.78 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory