Align histidinol-phosphatase (EC 3.1.3.15); inositol-phosphate phosphatase (EC 3.1.3.25) (characterized)
to candidate 5209868 Shew_2321 inositol monophosphatase (RefSeq)
Query= BRENDA::Q6NPM8 (346 letters) >FitnessBrowser__PV4:5209868 Length = 267 Score = 110 bits (276), Expect = 3e-29 Identities = 71/225 (31%), Positives = 115/225 (51%), Gaps = 13/225 (5%) Query: 94 ADASGEVIRKYFRK--KFDIVDKDDMSPVTIADQMAEEAMVSIIFQNLPSHAIYGEEKGW 151 A A+G+ I + + + + ++ K VT D+ AE A+ I ++ P H I GEE G Sbjct: 12 ARAAGQTIMRAYTELDRVEVSAKGINDYVTNVDKEAEAAITYQIRKSYPDHTIVGEENGE 71 Query: 152 RCKEESADYVWVLDPIDGTKSFITGKPVFGTLIALLYKGKPILGLIDQPILKERWIGMNG 211 K +++DY+W++DP+DGT +F+ G P F IA+ +KGK + ++ P+ E + + G Sbjct: 72 N-KGQNSDYMWIVDPLDGTNNFVRGIPHFAVSIAVQHKGKTEVAVVYDPVRDELFTAVRG 130 Query: 212 RRTKLNGEDISTRSCPKLSQAYLYTTSPHLFSEEAE-------KAYSRVRDKVKVPLYGC 264 + KLN I L +A + T P + E +S+ D + G Sbjct: 131 KGAKLNDFRIRVSKASDLDEAIVGTGFPFKAKQHTETYMKLFASTFSQCADLRRA---GS 187 Query: 265 DCYAYALLASGFVDLVIESGLKPYDFLALVPVIEGAGGTITDWTG 309 A +A+G +D E GLKP+D A ++ AGGT+TD+TG Sbjct: 188 AALDLAYVAAGRMDAFFEIGLKPWDIAAGDLIVREAGGTVTDFTG 232 Lambda K H 0.318 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 267 Length adjustment: 27 Effective length of query: 319 Effective length of database: 240 Effective search space: 76560 Effective search space used: 76560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory