Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 5207769 Shew_0290 acetolactate synthase 2 regulatory subunit (RefSeq)
Query= BRENDA::P0ADG1 (87 letters) >FitnessBrowser__PV4:5207769 Length = 89 Score = 54.7 bits (130), Expect = 2e-13 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 14 PETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHV 73 PE +ERVLRV RHRGF V M+M D + + V S R+++LL QLNKL+DV Sbjct: 13 PEVIERVLRVTRHRGFKVTEMDM-HLGDNGTTRLGMVVESERALELLSHQLNKLIDVTEC 71 Query: 74 AI 75 + Sbjct: 72 EV 73 Lambda K H 0.323 0.128 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 29 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 87 Length of database: 89 Length adjustment: 9 Effective length of query: 78 Effective length of database: 80 Effective search space: 6240 Effective search space used: 6240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 39 (19.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory