Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate 5209391 Shew_1862 succinyl-diaminopimelate desuccinylase (RefSeq)
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__PV4:5209391 Length = 376 Score = 530 bits (1364), Expect = e-155 Identities = 254/371 (68%), Positives = 297/371 (80%) Query: 6 VLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLFVF 65 VL LA++LI+R SVTP D GCQ LM +RL A GF IE MVFEDTTN WARRG Q PLF F Sbjct: 5 VLTLAQDLIARASVTPLDEGCQPLMAKRLAAKGFNIEPMVFEDTTNMWARRGDQGPLFCF 64 Query: 66 AGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHPDHQG 125 AGHTDVVP G L++WHTPPFEP VIDG+LHGRGAADMKGSLA M+VA ERF+ +HPDH+G Sbjct: 65 AGHTDVVPVGDLNRWHTPPFEPVVIDGYLHGRGAADMKGSLAAMVVATERFVDKHPDHKG 124 Query: 126 SIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGSITG 185 SI FLITSDEEGPFINGT RV++TL ARNE I +VGEPSST +GD+VKNGRRGS+TG Sbjct: 125 SIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKNGRRGSLTG 184 Query: 186 DLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGTGAS 245 +L VKG QGHVAYPHLA+NP+HKA PAL ELA +WD GN +FPPTSFQI N+ GTGAS Sbjct: 185 NLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIANINGGTGAS 244 Query: 246 NVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGELLAA 305 NVIPG +V FNFR+STE+T E + +RV ++LDAHGLDYD+ W +G PFLTD G LL A Sbjct: 245 NVIPGSLEVMFNFRYSTEVTAEILIQRVLNILDAHGLDYDISWIFNGLPFLTDAGPLLDA 304 Query: 306 VVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLEKLT 365 A+ E+ T+GGTSDGRFIA GAQV+ELGPVNATIHKVNECV++ D+E+L Sbjct: 305 TREAIYEITGTETDPQTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKVEDIEQLA 364 Query: 366 DMYQKTLNHLL 376 +Y++ L LL Sbjct: 365 KVYERILEKLL 375 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 376 Length adjustment: 30 Effective length of query: 347 Effective length of database: 346 Effective search space: 120062 Effective search space used: 120062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 5209391 Shew_1862 (succinyl-diaminopimelate desuccinylase (RefSeq))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.7574.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-175 567.6 0.0 6.3e-175 567.5 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209391 Shew_1862 succinyl-diaminopimela Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209391 Shew_1862 succinyl-diaminopimelate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 567.5 0.0 6.3e-175 6.3e-175 2 370 .] 6 374 .. 5 374 .. 0.99 Alignments for each domain: == domain 1 score: 567.5 bits; conditional E-value: 6.3e-175 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWssdp 79 l la++Li r svtP d+g+q l+a+rL + gf+ie + fedt+n+wa+rg + p ++faGhtDvvP+G+l++W+++p lcl|FitnessBrowser__PV4:5209391 6 LTLAQDLIARASVTPLDEGCQPLMAKRLAAKGFNIEPMVFEDTTNMWARRGDQGPLFCFAGHTDVVPVGDLNRWHTPP 83 679*************************************************************************** PP TIGR01246 80 fepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidyavv 157 fep+++dG+l+grGaaDmkgslaa+vva+erfv k++dhkGs+++litsDeeg +i+Gt++v++tl++r+e+i++++v lcl|FitnessBrowser__PV4:5209391 84 FEPVVIDGYLHGRGAADMKGSLAAMVVATERFVDKHPDHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLV 161 ****************************************************************************** PP TIGR01246 158 gePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqianiea 235 gePss++klGD++k+GrrGs+tg+l++kG+qGhvaYPh+a+nP+hka+p+l el+ +k+D+Gneffpp+s+qiani++ lcl|FitnessBrowser__PV4:5209391 162 GEPSSTHKLGDIVKNGRRGSLTGNLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIANING 239 ****************************************************************************** PP TIGR01246 236 gtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevlkkkp 313 gtgasnviPg+l+v+fn+r+s+ev++e l ++v +ild+h+ldY++ w + g pflt++g l+++ +eai e++++++ lcl|FitnessBrowser__PV4:5209391 240 GTGASNVIPGSLEVMFNFRYSTEVTAEILIQRVLNILDAHGLDYDISWIFNGLPFLTDAGPLLDATREAIYEITGTET 317 ****************************************************************************** PP TIGR01246 314 elstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 + +tsGGtsD+rfia ga+v+elG+vn+tihkvne+vk+ed+e+l++vye++le+l lcl|FitnessBrowser__PV4:5209391 318 DPQTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKVEDIEQLAKVYERILEKL 374 ******************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory