GapMind for Amino acid biosynthesis

 

Aligments for a candidate for asp-kinase in Shewanella loihica PV-4

Align fused aspartate kinase/homoserine dehydrogenase 1 (EC 2.7.2.4; EC 1.1.1.3) (characterized)
to candidate 5208568 Shew_1079 bifunctional aspartokinase I/homeserine dehydrogenase I (RefSeq)

Query= ecocyc::ASPKINIHOMOSERDEHYDROGI-MONOMER
         (820 letters)



>lcl|FitnessBrowser__PV4:5208568 Shew_1079 bifunctional
           aspartokinase I/homeserine dehydrogenase I (RefSeq)
          Length = 822

 Score =  913 bits (2359), Expect = 0.0
 Identities = 469/818 (57%), Positives = 596/818 (72%), Gaps = 4/818 (0%)

Query: 1   MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA 60
           M+V+KFGGTS+AN +RF   A I+ ++A +   A VLSAPA +TN L+ M++  ++G D 
Sbjct: 1   MKVMKFGGTSLANWQRFNSAAQIVLASAAEQPTAVVLSAPATVTNGLLEMVDLAVAGDDF 60

Query: 61  LPNISDAERIFAELLTGLAAAQ--PGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSI 118
            P +S    +F + L G AA++   G     L+  +  +    +  L G+ LLG+CPD++
Sbjct: 61  FPVLSQVHEVF-KTLYGQAASEVLSGEQSDSLEAVLAAQLKHWQDKLQGVVLLGECPDAV 119

Query: 119 NAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASR 178
            A ++  GE++S A+M  ++ A G +   + P +  +A G  LES VDIA S +R A   
Sbjct: 120 RAEIVVGGERLSAALMEQLMLAAGVSANQLVPQQLFVAHGPALESVVDIAASKQRFAELS 179

Query: 179 IPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPR 238
           + A  + +M GFTAG++ G +V LGRNGSDYSAAVL+AC+ A CCEIWTDVDGVY  DPR
Sbjct: 180 LDAHQVWVMPGFTAGDKDGRVVTLGRNGSDYSAAVLSACIDASCCEIWTDVDGVYNTDPR 239

Query: 239 QVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGAS 298
            V DA+LL  +SYQEAMELSYFGAKVLHP+TI PIAQ+ IPC I+N+ NPQAPGTL+   
Sbjct: 240 VVADAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIRNSFNPQAPGTLVSNQ 299

Query: 299 RDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSI 358
            DE  L VK ISNL+   MF ++GPGMKGMVGMA+R   A+SR+ +SV LITQSSSEYSI
Sbjct: 300 VDETGLNVKAISNLDEQTMFDIAGPGMKGMVGMASRTLGAISRSGVSVSLITQSSSEYSI 359

Query: 359 SFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFA 418
           SFCV   D  R   A+++EF LELK  +LE +A+   LAI+S++GDGMRT +G++ KFF 
Sbjct: 360 SFCVATQDAERVRVALEQEFELELKSEILEQIAMRHNLAIVSLIGDGMRTHKGVAGKFFQ 419

Query: 419 ALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGG 478
           ALA+AN+NIVAIAQGSSERSIS V+        +   HQ LF+    ++VF++G G VG 
Sbjct: 420 ALAQANVNIVAIAQGSSERSISAVIELRKTKHAIAACHQSLFDVQHYLDVFLVGCGNVGA 479

Query: 479 ALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLENWQEELAQAKEPFNLGRLI 538
            LLEQ+K+Q   LK +HI +RVCGVANS+ +L +  G++L +WQ  LA +++  +L +++
Sbjct: 480 GLLEQIKQQTEMLKAQHITVRVCGVANSRHMLLDAKGIDLNHWQGLLADSQQACDLDKML 539

Query: 539 RLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSMDYYHQLRYAAEK 598
              K+  LLNPV+VDCTS++AV+DQY   +  G HVVTPNKKANT   DYY  LR  A  
Sbjct: 540 AWAKDQQLLNPVLVDCTSNEAVSDQYVAVMNAGLHVVTPNKKANTRDYDYYRALRQTALH 599

Query: 599 SRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSEATT 658
            RR+FLY+T VGAGLPVI+NL+ LL AGD+L KF+GILSGSLSYIFG LDEGMS SEAT 
Sbjct: 600 QRRQFLYETTVGAGLPVIDNLKKLLFAGDKLQKFNGILSGSLSYIFGMLDEGMSLSEATG 659

Query: 659 LAREMGYTEPDPRDDLSGMDVARKLLILARETGRELELADIEIEPVLPAEFNAEGDVAAF 718
           +ARE  +TEPDPRDDLSGMDVARK+LILARE G ++EL+DI++E VLP+ F+A GDV  F
Sbjct: 660 IAREKCFTEPDPRDDLSGMDVARKVLILAREVGMQIELSDIQVESVLPSHFDASGDVETF 719

Query: 719 MANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGVCRVKIAEVDGNDPLFKVKNGENAL 778
           MANLS LD   A RV  A+  GKVLRYVG IDE+G CRVKIAEVD  DPL+ VK GENAL
Sbjct: 720 MANLSALDGELAERVNSAKAAGKVLRYVGQIDEEG-CRVKIAEVDAKDPLYSVKGGENAL 778

Query: 779 AFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSW 816
           AFYS YYQP+P VLRGYGAG +VTAAGVFADLLRTL+W
Sbjct: 779 AFYSRYYQPIPFVLRGYGAGTEVTAAGVFADLLRTLNW 816


Lambda     K      H
   0.319    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1515
Number of extensions: 40
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 820
Length of database: 822
Length adjustment: 42
Effective length of query: 778
Effective length of database: 780
Effective search space:   606840
Effective search space used:   606840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)

Align candidate 5208568 Shew_1079 (bifunctional aspartokinase I/homeserine dehydrogenase I (RefSeq))
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00657.hmm
# target sequence database:        /tmp/gapView.22671.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00657  [M=442]
Accession:   TIGR00657
Description: asp_kinases: aspartate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
   1.1e-128  416.0   1.1   1.3e-128  415.7   1.1    1.1  1  lcl|FitnessBrowser__PV4:5208568  Shew_1079 bifunctional aspartoki


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__PV4:5208568  Shew_1079 bifunctional aspartokinase I/homeserine dehydrogenase I (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  415.7   1.1  1.3e-128  1.3e-128       5     441 ..       3     461 ..       1     462 [. 0.92

  Alignments for each domain:
  == domain 1  score: 415.7 bits;  conditional E-value: 1.3e-128
                        TIGR00657   5 VqKFGGtSvgnverikkvakivkkekekgnqvvVVvSAmagvTdaLvelaekvsseee....keliekirekhleale 78 
                                      V+KFGGtS++n +r++ +a+iv+++++++ + +VV+SA+a vT+ L+e+++ +  +++     +++++++++ + +++
  lcl|FitnessBrowser__PV4:5208568   3 VMKFGGTSLANWQRFNSAAQIVLASAAEQ-PTAVVLSAPATVTNGLLEMVDLAVAGDDffpvLSQVHEVFKTLYGQAA 79 
                                      9*************************666.***************************998886777778888777777 PP

                        TIGR00657  79 ela.sqalkeklkallekeleevkk............ereldlilsvGEklSaallaaaleelgvkavsllgaeagil 143
                                      ++  s + +  l+a+l+++l++ +             ++ +++i+  GE+lSaal+ +++ + gv a +l+  ++  +
  lcl|FitnessBrowser__PV4:5208568  80 SEVlSGEQSDSLEAVLAAQLKHWQDklqgvvllgecpDAVRAEIVVGGERLSAALMEQLMLAAGVSANQLVP-QQLFV 156
                                      77767777777777777777776668999***********************************77777765.55667 PP

                        TIGR00657 144 tdsefgrAkvleeikterl.eklleegiivvvaGFiGatekgeittLGRGGSDltAallAaalkAdeveiytDVdGiy 220
                                      +++  ++++v + ++++r  e  l++ ++ v+ GF++ +++g+++tLGR+GSD++Aa+l a+++A+++ei+tDVdG+y
  lcl|FitnessBrowser__PV4:5208568 157 AHGPALESVVDIAASKQRFaELSLDAHQVWVMPGFTAGDKDGRVVTLGRNGSDYSAAVLSACIDASCCEIWTDVDGVY 234
                                      777777777566666666515567888*************************************************** PP

                        TIGR00657 221 taDPrivpeArrldeisyeEalELaslGakvLhprtlepamrakipivvkstfnpeaeGTlivakskseeepavkals 298
                                       +DPr+v +A++l ++sy+Ea+EL+++GakvLhp+t+ p++++ ip+ ++++fnp+a+GTl+ ++ + e   +vka+s
  lcl|FitnessBrowser__PV4:5208568 235 NTDPRVVADAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIRNSFNPQAPGTLVSNQVD-ETGLNVKAIS 311
                                      *****************************************************************88.666******* PP

                        TIGR00657 299 ldknqalvsvsgttmk..pgilaevfgalaeakvnvdlilqsssetsisfvvdkedadkakellk...kkvkeekale 371
                                      + ++q++++++g++mk  +g++++ +ga+++ +v+v li+qssse+sisf+v ++da++   +l+   + +++ + le
  lcl|FitnessBrowser__PV4:5208568 312 NLDEQTMFDIAGPGMKgmVGMASRTLGAISRSGVSVSLITQSSSEYSISFCVATQDAERVRVALEqefELELKSEILE 389
                                      **********************************************************9999998777788999**** PP

                        TIGR00657 372 evevekklalvslvGagmksapgvaakifeaLaeeniniemis..sseikisvvvdekdaekavealheklv 441
                                      ++ + ++la+vsl+G+gm++++gva+k+f+aLa++n+ni++i+  sse++is v++ ++ ++a+ a h+ l+
  lcl|FitnessBrowser__PV4:5208568 390 QIAMRHNLAIVSLIGDGMRTHKGVAGKFFQALAQANVNIVAIAqgSSERSISAVIELRKTKHAIAACHQSLF 461
                                      *********************************************************************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (442 nodes)
Target sequences:                          1  (822 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 11.23
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory