Align P-protein; EC 4.2.1.51; EC 5.4.99.5 (characterized)
to candidate 5208561 Shew_1072 chorismate mutase (RefSeq)
Query= CharProtDB::CH_024084 (386 letters) >FitnessBrowser__PV4:5208561 Length = 654 Score = 416 bits (1070), Expect = e-121 Identities = 213/383 (55%), Positives = 280/383 (73%), Gaps = 1/383 (0%) Query: 1 MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLI 60 MT +PL RE+I+ALD +LLALLA+RR L+++V ++K + RP+RD RE++LL RL+ Sbjct: 1 MTKPHPLSHTREQITALDNELLALLAKRRALSLDVARSKEVDIRPIRDTQREKELLARLV 60 Query: 61 TLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNK-INPHSARIAFLGPKGSYSHLA 119 G+ LDAHY+ L+Q IIEDSVL QQA LQ N + IA+LG +GSYS+LA Sbjct: 61 KQGREQGLDAHYVLSLYQSIIEDSVLNQQAYLQGRANPDLQKQQYNIAYLGARGSYSYLA 120 Query: 120 ARQYAARHFEQFIESGCAKFADIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLS 179 A +Y R + GC F +I VE+G ADY +PIENTSSG+IN+VYD+LQHTSL+ Sbjct: 121 ATRYCERRQVGMQDLGCKSFDEIVQAVESGHADYGFLPIENTSSGSINEVYDVLQHTSLA 180 Query: 180 IVGEMTLTIDHCLLVSGTTDLSTINTVYSHPQPFQQCSKFLNRYPHWKIEYTESTSAAME 239 IVGE T+ + HCLL T++ I T+Y+HPQP QCS++L+++ +K+EY S++ AME Sbjct: 181 IVGETTIEVGHCLLAKPGTNVKQIKTIYAHPQPISQCSRYLSQHGEFKLEYCSSSAEAME 240 Query: 240 KVAQAKSPHVAALGSEAGGTLYGLQVLERIEANQRQNFTRFVVLARKAINVSDQVPAKTT 299 +V +A VAA+GS GG LY L+ +E ANQ+ N +RF+V+ARKAI V +Q+PAKTT Sbjct: 241 RVLEADDNSVAAIGSVEGGALYQLEAVEHELANQKINQSRFIVVARKAIAVPEQLPAKTT 300 Query: 300 LLMATGQQAGALVEALLVLRNHNLIMTRLESRPIHGNPWEEMFYLDIQANLESAEMQKAL 359 L+MATGQ+ GALVEALL+L+ H+L M++LESRPI G PWEEMFYLD+ ANL S EMQ+AL Sbjct: 301 LIMATGQKPGALVEALLILKAHDLNMSKLESRPIPGTPWEEMFYLDLDANLASDEMQQAL 360 Query: 360 KELGEITRSMKVLGCYPSENVVP 382 KEL ITR +KVLGCYP E V P Sbjct: 361 KELERITRFIKVLGCYPCETVNP 383 Lambda K H 0.318 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 654 Length adjustment: 34 Effective length of query: 352 Effective length of database: 620 Effective search space: 218240 Effective search space used: 218240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate 5208561 Shew_1072 (chorismate mutase (RefSeq))
to HMM TIGR01797 (chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01797.hmm # target sequence database: /tmp/gapView.21280.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01797 [M=83] Accession: TIGR01797 Description: CM_P_1: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-31 92.4 2.9 2.1e-30 91.0 2.9 1.8 1 lcl|FitnessBrowser__PV4:5208561 Shew_1072 chorismate mutase (Ref Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208561 Shew_1072 chorismate mutase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.0 2.9 2.1e-30 2.1e-30 1 83 [] 7 89 .. 7 89 .. 0.98 Alignments for each domain: == domain 1 score: 91.0 bits; conditional E-value: 2.1e-30 TIGR01797 1 llalrekisaidkkllkllaerkelafevakskllsqkavrdierekkllqklitlgkkyqleaeyitrlfqliiedsvl 80 l+ re+i+a+d++ll+lla r+ l ++va+sk+++ +++rd +rek+ll +l++ g++ l+a+y+ +l+q iiedsvl lcl|FitnessBrowser__PV4:5208561 7 LSHTREQITALDNELLALLAKRRALSLDVARSKEVDIRPIRDTQREKELLARLVKQGREQGLDAHYVLSLYQSIIEDSVL 86 6789**************************************************************************** PP TIGR01797 81 tqq 83 qq lcl|FitnessBrowser__PV4:5208561 87 NQQ 89 *98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (83 nodes) Target sequences: 1 (654 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 21.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory