GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Shewanella loihica PV-4

Align aspartate aminotransferase (EC 2.6.1.1) (characterized)
to candidate 5209481 Shew_1951 aromatic amino acid aminotransferase (RefSeq)

Query= metacyc::MONOMER-13012
         (397 letters)



>lcl|FitnessBrowser__PV4:5209481 Shew_1951 aromatic amino acid
           aminotransferase (RefSeq)
          Length = 396

 Score =  483 bits (1243), Expect = e-141
 Identities = 230/395 (58%), Positives = 292/395 (73%), Gaps = 1/395 (0%)

Query: 1   MFSVLKPLPTDPILGLMAAYKQDTNPNKIDLGVGVYKDELGNTPVLKAVKKAEAFRLENE 60
           MF  L P+P DPILGLM  +++D + NK+DLGVGVYKDE GNTP+L  VK+AE  R++ E
Sbjct: 1   MFENLSPMPADPILGLMTKFREDPHANKVDLGVGVYKDEAGNTPILACVKRAEQHRIDTE 60

Query: 61  TSKSYIGLAGNLDYCQKMESLLLGE-HKTLLANRVRTAQAPGGTGALRVAAEFIMRCNPK 119
            +K YIG  G+  + Q M  L  G+ +  LLA+R+RT   PGGTGALRVAA+FI R NP 
Sbjct: 61  ATKVYIGPTGSPAFNQLMGELAFGQDNPALLADRIRTVSTPGGTGALRVAADFIKRVNPN 120

Query: 120 ATVWVTTPTWANHISLFEAAGLTVKEYPYYDYENKDLLFDEMINTLKQVPKGDVVLLHAC 179
           + +WV+ PTWANH  LFEAAG+ VK YPYYDY+NK L FDEM+  L Q+   DVVL HAC
Sbjct: 121 SVIWVSDPTWANHTGLFEAAGIKVKTYPYYDYQNKTLKFDEMLAALSQIGADDVVLFHAC 180

Query: 180 CHNPSGMDLNEAQWKVVAELAKEVGFTPLVDIAYQGFGSSLEEDARGLRILADAVEELII 239
           CHNPSGMDL   QW  V  L K+ GFTPL+D+AYQGFG  ++EDA G+R +A  V+++I+
Sbjct: 181 CHNPSGMDLTNEQWDQVIALTKQQGFTPLIDMAYQGFGDGVDEDAYGVRQMAANVDDMIL 240

Query: 240 CSSCSKNFGLYRERIGACSLIAKDSATADISNSVLLSVVRSIYSMPPAHGADIVNTILSS 299
           CSSCSKNFGLYRERIGACS++ KDS +A+++ SVLL VVR IYSMPPAHGA IV TIL S
Sbjct: 241 CSSCSKNFGLYRERIGACSIVGKDSHSANVAYSVLLYVVRCIYSMPPAHGAAIVETILGS 300

Query: 300 TELTQMWHQELDEMRSRINGLRTQIKETLATKDIAQDFSFIERQHGMFSFLGINKEQITR 359
           +EL Q W  EL  MR RING R  +   L  K + +DFSFI +Q GMFSFLG+  EQ+ +
Sbjct: 301 SELKQQWLDELKVMRDRINGNRAMLVNKLIEKGVTRDFSFIAKQKGMFSFLGVTPEQVAK 360

Query: 360 LQKEYGIYIVGSSRVNVAGVSDANIEYFANAVADV 394
           LQ ++ IY+V SSR+++AG+ + N++Y A ++A V
Sbjct: 361 LQADHSIYMVDSSRISIAGIGEGNVDYLAESIAKV 395


Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 469
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 396
Length adjustment: 31
Effective length of query: 366
Effective length of database: 365
Effective search space:   133590
Effective search space used:   133590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory