GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proC in Shewanella loihica PV-4

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate 5208627 Shew_1136 pyrroline-5-carboxylate reductase (RefSeq)

Query= curated2:P52053
         (272 letters)



>FitnessBrowser__PV4:5208627
          Length = 272

 Score =  276 bits (707), Expect = 3e-79
 Identities = 142/272 (52%), Positives = 186/272 (68%)

Query: 1   MEHKKIAFIGAGNMVRAIVSGLVANGYPAQNITATAPSEARRLPLEQDFGIRTTSDNIQA 60
           M  KKI FIGAGNM R+I SGLV  GY  + I AT PSE + + L+QD GIR + DN+QA
Sbjct: 1   MTQKKICFIGAGNMTRSITSGLVKGGYAPELIHATNPSEGKLIALKQDLGIRVSHDNLQA 60

Query: 61  ATEADVVVLSVKPQMMADVCKPLQAIDFTNKLVISIAAGINCSRLDDMLATKLNLVRVMP 120
           A EADV+VL+VKPQ+M  VC+ +  ++  +KL+++IAAG+   R        + L+R MP
Sbjct: 61  ADEADVIVLAVKPQLMQQVCEAMSGLNLKDKLIVTIAAGVTAERYHAFFKQPIQLIRTMP 120

Query: 121 NTPSQLGLGMSGLFAPIHVTEHDKAFAAELMEAVGKVCWVEQESGINNVIAAAGSAPAYF 180
           NTP+Q+GLGM+GL+A   V+  D+    +LM+  G+  WVE+E  +N VIA AGS+PAYF
Sbjct: 121 NTPTQIGLGMTGLYAEQGVSAQDRELCEQLMQTGGETVWVEKEEDLNQVIALAGSSPAYF 180

Query: 181 FLFMEAMQAEAIAQGFDKESARLLVQQAALGAASMVVSNPETELSTLRENVTSKGGTTAE 240
           FL MEAM   A   G D+++AR +VQQAALGAA+MV  NP+   + LRENVTSKGGTTA+
Sbjct: 181 FLMMEAMIDSAKQDGVDEQTAREMVQQAALGAAAMVKQNPQLSPAQLRENVTSKGGTTAQ 240

Query: 241 ALRTFNEHQLSDIVAKAMQAAVARAEEMEKLF 272
           AL  F    L +IV  AM   + RA+EM K F
Sbjct: 241 ALAAFERAGLREIVRTAMHDCMDRAQEMAKQF 272


Lambda     K      H
   0.317    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 212
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 272
Length of database: 272
Length adjustment: 25
Effective length of query: 247
Effective length of database: 247
Effective search space:    61009
Effective search space used:    61009
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate 5208627 Shew_1136 (pyrroline-5-carboxylate reductase (RefSeq))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.25438.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.25438.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.