GapMind for Amino acid biosynthesis

 

Aligments for a candidate for thrB in Shewanella loihica PV-4

Align homoserine kinase; EC 2.7.1.39 (characterized)
to candidate 5208569 Shew_1080 homoserine kinase (RefSeq)

Query= CharProtDB::CH_002113
         (310 letters)



>lcl|FitnessBrowser__PV4:5208569 Shew_1080 homoserine kinase
           (RefSeq)
          Length = 316

 Score =  352 bits (903), Expect = e-102
 Identities = 172/304 (56%), Positives = 222/304 (73%), Gaps = 1/304 (0%)

Query: 4   VYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAA-ETFSLNNLGRFADKLPSEPRE 62
           VYAPAS  N+ VGFD+LGAA+ PVDG LLGD V +E+A    SL+  G +ADKLP+   E
Sbjct: 5   VYAPASMGNVGVGFDLLGAALAPVDGCLLGDRVAIESAPHGVSLSLAGHWADKLPAASEE 64

Query: 63  NIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLNDTR 122
           NIVYQC   F ++LG +  VAMTLEKN+P+GSGLGSSA SVVAAL A+NEH  +P +   
Sbjct: 65  NIVYQCATFFLEQLGSRAGVAMTLEKNLPVGSGLGSSASSVVAALYALNEHFDRPYDSDA 124

Query: 123 LLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGIKV 182
           LL LMGE EG+ISGS+HYDNVAPC+LGGMQLM++    + Q +P F +W WV+AYPGI +
Sbjct: 125 LLRLMGEFEGKISGSVHYDNVAPCYLGGMQLMLDTPSAVCQGLPVFKDWYWVVAYPGISL 184

Query: 183 STAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLPGF 242
           STA+ RA+LPAQY +   I  GR+L+ F+HA Y +  +LA +++KDV+AEPYR   +PG+
Sbjct: 185 STAKMRALLPAQYDKSVAIDFGRYLSAFVHASYRQDAKLAIEVLKDVLAEPYRASEIPGY 244

Query: 243 RQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRLDT 302
            QAR A+ E+G   +GISGSGPTLF++ D  ETA +   WL  NY+ +  GF HIC++D 
Sbjct: 245 EQARAALDELGMATTGISGSGPTLFSVTDNLETANKAKAWLDANYVTSGSGFSHICQIDM 304

Query: 303 AGAR 306
            G R
Sbjct: 305 LGTR 308


Lambda     K      H
   0.321    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 307
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 310
Length of database: 316
Length adjustment: 27
Effective length of query: 283
Effective length of database: 289
Effective search space:    81787
Effective search space used:    81787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate 5208569 Shew_1080 (homoserine kinase (RefSeq))
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00191.hmm
# target sequence database:        /tmp/gapView.22214.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00191  [M=304]
Accession:   TIGR00191
Description: thrB: homoserine kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
      7e-90  286.9   0.0    7.8e-90  286.7   0.0    1.0  1  lcl|FitnessBrowser__PV4:5208569  Shew_1080 homoserine kinase (Ref


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__PV4:5208569  Shew_1080 homoserine kinase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  286.7   0.0   7.8e-90   7.8e-90       1     300 [.       3     308 ..       3     312 .. 0.98

  Alignments for each domain:
  == domain 1  score: 286.7 bits;  conditional E-value: 7.8e-90
                        TIGR00191   1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdk..sleaegegvekipkesdkNliyqvakkvlkklgk 76 
                                      l+v++Pas  N+g+GfD lG+al +v+++l+++ va+es+ +  sl  +g+ ++k+p+ s++N++yq+a+ +l++lg 
  lcl|FitnessBrowser__PV4:5208569   3 LTVYAPASMGNVGVGFDLLGAALAPVDGCLLGDRVAIESAPHgvSLSLAGHWADKLPAASEENIVYQCATFFLEQLGS 80 
                                      68***********************************9999999********************************** PP

                        TIGR00191  77 rvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg......HpDNvapallGGlqlav 148
                                      r  +v++t+ek++p+g+GLGSSa+++vaa++a+ne+++ +++   ll l+++ Eg      H+DNvap++lGG+ql++
  lcl|FitnessBrowser__PV4:5208569  81 R-AGVAMTLEKNLPVGSGLGSSASSVVAALYALNEHFDRPYDSDALLRLMGEFEGkisgsvHYDNVAPCYLGGMQLML 157
                                      *.**************************************************************************** PP

                        TIGR00191 149 keddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvtAlvskdkadllaiamkDrvh 226
                                           ++++ +P ++++++v+++P+i++sTa+ Ra+LP++y+ + ++  ++ l+ +v+A + +  a+l+  ++kD+++
  lcl|FitnessBrowser__PV4:5208569 158 DTPS-AVCQGLPVFKDWYWVVAYPGISLSTAKMRALLPAQYDKSVAIDFGRYLSAFVHASYRQ-DAKLAIEVLKDVLA 233
                                      *999.**********************************************************.89999999****** PP

                        TIGR00191 227 qpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eekaqelleklakegieltvkvleldtdgae 300
                                      +pyR++ iP++++ + a  e g+ ++++SG+Gpt+++++++ + ++ka+ +l+ ++     ++++++++d+ g++
  lcl|FitnessBrowser__PV4:5208569 234 EPYRASEIPGYEQARAALDELGMATTGISGSGPTLFSVTDNLEtANKAKAWLDANYVTSGSGFSHICQIDMLGTR 308
                                      ******************************************99**************************99986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (316 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.56
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory