Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate 5209799 Shew_2252 anthranilate synthase component II (RefSeq)
Query= SwissProt::P00900 (193 letters) >FitnessBrowser__PV4:5209799 Length = 202 Score = 207 bits (527), Expect = 1e-58 Identities = 102/187 (54%), Positives = 138/187 (73%), Gaps = 1/187 (0%) Query: 4 ILLLDNVDSFTYNLVDQLRASGHQVVIYRNQIGAEVIIERL-QHMEQPVLMLSPGPGTPS 62 + LLDN DSFTYNLVDQ R+ G +VVIYRN + A+ I ++L Q + L+LSPGPG P Sbjct: 3 LYLLDNFDSFTYNLVDQFRSLGFEVVIYRNDLDAQFIADKLLQEQGKAALVLSPGPGAPH 62 Query: 63 EAGCMPELLQRLRGQLPIIGICLGHQAIVEAYGGQVGQAGEILHGKASAIAHDGEGMFAG 122 EAGC+ L+ L G++P++GICLGHQA++E +GG+V +A +++HGKAS H+ +G+FAG Sbjct: 63 EAGCLMALIGLLAGKVPMLGICLGHQAMIEHFGGKVERAKQVVHGKASPTIHNCQGIFAG 122 Query: 123 MANPLPVARYHSLVGSNIPADLTVNARSGEMVMAVRDDRRRVCGFQFHPESILTTHGARL 182 + +PLPVARYHSLV + +P L V A + EM MA+ + GFQFHPESILTT G++L Sbjct: 123 LPSPLPVARYHSLVATQVPDCLEVIATTEEMPMAISHKSVKAVGFQFHPESILTTLGSQL 182 Query: 183 LEQTLAW 189 L QTL + Sbjct: 183 LTQTLTY 189 Lambda K H 0.322 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 193 Length of database: 202 Length adjustment: 20 Effective length of query: 173 Effective length of database: 182 Effective search space: 31486 Effective search space used: 31486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 5209799 Shew_2252 (anthranilate synthase component II (RefSeq))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.18161.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-59 186.2 0.1 3.1e-59 186.0 0.1 1.0 1 lcl|FitnessBrowser__PV4:5209799 Shew_2252 anthranilate synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209799 Shew_2252 anthranilate synthase component II (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.0 0.1 3.1e-59 3.1e-59 2 190 .. 3 187 .. 2 189 .. 0.94 Alignments for each domain: == domain 1 score: 186.0 bits; conditional E-value: 3.1e-59 TIGR00566 2 vllidnydsftynlvqlleelgaevvvkrndsltlqeieallplls...ivisPGPctPdeaaissleliehlaGklP 76 + l+dn+dsftynlv+++ lg evv+ rnd + ++ll ++ +v+sPGP+ P+ea+ ++li laGk+P lcl|FitnessBrowser__PV4:5209799 3 LYLLDNFDSFTYNLVDQFRSLGFEVVIYRNDLDAQFIADKLLQEQGkaaLVLSPGPGAPHEAGCL-MALIGLLAGKVP 79 5699***************************998888888887765566***************9.99********** PP TIGR00566 77 ilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeee 154 +lG+ClGhqa+ fG++v ra++v hGk s hn +++fagl +P l+++ryhslv a +++++lev a++ee lcl|FitnessBrowser__PV4:5209799 80 MLGICLGHQAMIEHFGGKVERAKQVVHGKASPTIHNCQGIFAGLPSP--LPVARYHSLV--ATQVPDCLEVIATTEEM 153 ***********************************************..*********8..689*******9999887 PP TIGR00566 155 ieimairhrdlpleGvqfhPesilselGkellanfl 190 mai h+ ++ G qfhPesil+ lG++ll+ l lcl|FitnessBrowser__PV4:5209799 154 --PMAISHKSVKAVGFQFHPESILTTLGSQLLTQTL 187 ..7****************************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (202 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory