Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate 5209800 Shew_2253 anthranilate phosphoribosyltransferase (RefSeq)
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__PV4:5209800 Length = 349 Score = 255 bits (651), Expect = 1e-72 Identities = 141/323 (43%), Positives = 200/323 (61%), Gaps = 10/323 (3%) Query: 10 GEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPL--- 66 G+ + EE + ++ G++ PV AG+LVA+ +RGE EI+ A A+ +AA+ Sbjct: 14 GQTISREETKALFSEIVEGKMDPVAMAGMLVAMKMRGETIDEISGAADALLQAAKAFPAP 73 Query: 67 --RVHRRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEA 124 + ++DIVGTGGDG +N+ST +A VAAA G VAKHGNR+ SS++GS+DLL Sbjct: 74 SEATRTQGIVDIVGTGGDGHNTINISTTSAFVAAAAGAKVAKHGNRSVSSKSGSSDLLAQ 133 Query: 125 LGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAG 184 G+DL PE + +++LG FLFA +H +RH PVR L RT+FN+LGPL NPA Sbjct: 134 FGIDLTMAPETARDCLDDLGLCFLFAPHYHGGVRHAVPVRQALKTRTLFNVLGPLINPAR 193 Query: 185 ADAYVLGVFSPEWLAPMAEALERLGA-RGLVVHGEGADEL-VLGENRVVEVGKG---AYA 239 D +LGV+ P + P+ + L+ L R +VVHG G DE+ V GE V E+ +G Y Sbjct: 194 PDYMLLGVYDPMLVRPICDVLKALDVKRAMVVHGSGLDEVAVHGETLVCELKQGEIVEYY 253 Query: 240 LTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPS 299 L+PE +GL RA + L G GP ENA + R +L+G + +AVA AG Y +G S Sbjct: 254 LSPEALGLSRAAISDLAGAGPAENAEITRAILQGHGELAHTEAVAANAGCALYVSGCCDS 313 Query: 300 LKEGVALAREVLASGEAYLLLER 322 ++G ALA + LASG+AY+LL++ Sbjct: 314 PQQGTALALQTLASGKAYILLQQ 336 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 349 Length adjustment: 28 Effective length of query: 301 Effective length of database: 321 Effective search space: 96621 Effective search space used: 96621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 5209800 Shew_2253 (anthranilate phosphoribosyltransferase (RefSeq))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.22809.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-128 413.8 0.1 3.3e-128 413.6 0.1 1.0 1 lcl|FitnessBrowser__PV4:5209800 Shew_2253 anthranilate phosphori Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209800 Shew_2253 anthranilate phosphoribosyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.6 0.1 3.3e-128 3.3e-128 2 328 .. 9 338 .. 8 340 .. 0.97 Alignments for each domain: == domain 1 score: 413.6 bits; conditional E-value: 3.3e-128 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke....eseelvDiv 75 +l++++++s+ee ++l++ei++g+++++ +a +lva++++get++ei+g+a al++ ak +++ ++ +vDiv lcl|FitnessBrowser__PV4:5209800 9 DRLYQGQTISREETKALFSEIVEGKMDPVAMAGMLVAMKMRGETIDEISGAADALLQAAKAFPAPseatRTQGIVDIV 86 5899*******************************************************99876422235788***** PP TIGR01245 76 GTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhp 153 GTGGDg +tiNiST+sa+vaaaaG+kvaKhGnrsvssksGs+D+L ++g+ l + pe ++ +l+++g++FlfAP+yh lcl|FitnessBrowser__PV4:5209800 87 GTGGDGHNTINISTTSAFVAAAAGAKVAKHGNRSVSSKSGSSDLLAQFGIDLTMAPETARDCLDDLGLCFLFAPHYHG 164 ****************************************************************************** PP TIGR01245 154 alkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkv 231 ++++++pvR+ L++rt+fN+LGPL+nPar+++ +lGvy++ lv+ + vlk+l vkra+vvhg +glDE++++get v lcl|FitnessBrowser__PV4:5209800 165 GVRHAVPVRQALKTRTLFNVLGPLINPARPDYMLLGVYDPMLVRPICDVLKALDVKRAMVVHG-SGLDEVAVHGETLV 241 ***************************************************************.************** PP TIGR01245 232 aelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegve 309 +elk+gei ey+lspe +gl ra +++l+g+ ++enae+++++l+g+++ a++++v++Na+ alyv+g ++ ++g+ lcl|FitnessBrowser__PV4:5209800 242 CELKQGEIVEYYLSPEALGLSRAAISDLAGAGPAENAEITRAILQGHGELAHTEAVAANAGCALYVSGCCDSPQQGTA 319 ****************************************************************************** PP TIGR01245 310 lakeaiksgkalekleelv 328 la++++ sgka+ +l++l+ lcl|FitnessBrowser__PV4:5209800 320 LALQTLASGKAYILLQQLA 338 ***************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.40 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory