Align asparagine synthase (glutamine-hydrolysing) 1; EC 6.3.5.4 (characterized)
to candidate CA265_RS01810 CA265_RS01810 asparagine synthase (glutamine-hydrolyzing)
Query= CharProtDB::CH_005185 (632 letters) >FitnessBrowser__Pedo557:CA265_RS01810 Length = 595 Score = 234 bits (598), Expect = 6e-66 Identities = 170/563 (30%), Positives = 270/563 (47%), Gaps = 18/563 (3%) Query: 1 MCGFVGVFNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDEHVGF--GFRRLSIIDV 58 MC G+ N + +Q+ +K M + H GPD G + E G RRL+I+D+ Sbjct: 1 MCRIAGIINSKNSFEKVNQQ--VKAMCDSMQHGGPDDHGIYTAEKTPLCLGNRRLAILDL 58 Query: 59 ENGG-QPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEA 117 + G QP+ E I +NGEIYNY ++R EL GY F T +DTEV+L Y+H+ E A Sbjct: 59 SSTGHQPMLSHKEDLVITYNGEIYNYKQIRTELINLGYIFKTQTDTEVILYAYQHWGETA 118 Query: 118 ASKLRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQNDIEID 177 KL G+FAF I++K + +Y RD GIKPLYY N+ + FASE K+ A D E D Sbjct: 119 FEKLDGIFAFCIFDKREQCVYLVRDQNGIKPLYYHFANETLTFASEVKAFKHANIDQEND 178 Query: 178 KEALQQYMSFQFVPEPSTLDAHVKKVEPGS--QFTIRPDGDITFKTYFKANFKPVQTEED 235 + Y++F +PEP T +V + GS ++ IR ++Y + E Sbjct: 179 NWRI-YYLAFGHIPEPYTTLKNVCSLGKGSFLKYNIR-SAQHLIQSYHEFESTSYIHNES 236 Query: 236 KLVKEVRDAIYDSVNVHMRSDVPVGSFLSGGIDSSFIVSVAKEF-HPSLKTFSVGFEQQG 294 ++ +R+ + S+ M SDV +G SGG+DSS I +A ++ + L + S F + Sbjct: 237 YAIERIREQLGHSIKQQMISDVDIGVLFSGGLDSSIITILANQYNNKQLSSISANFNEID 296 Query: 295 FSEVDVAKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYFVAKEAKK 354 FSE + ++ I ++I+ +++ ++ D P D I +FV K AK Sbjct: 297 FSEKKQRNSLLQKINLQKIEQLITYRDFVQNFETVLADMDQPTND--GINTWFVCKTAKA 354 Query: 355 H-VTVALSGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVAAVMPEGMRGKSLLE 413 + + V LSG GADELFGGY + ++ + L K L + + K L Sbjct: 355 NGIKVVLSGLGADELFGGYPSFDRIHKIQNL----NWLSKSALR-STRFSNNTKFKRLYY 409 Query: 414 RGCTPLQDRYIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTYFTESSSYSDINKMQYVDI 473 Y+ ++ V +LL + S+ + + + Sbjct: 410 LSLNSPIGEYLCLRGVYSPDVIAELLDIDMKTVIDCLEDIPLHPGIKKTSNETRASWFEF 469 Query: 474 HTWMRGDILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTTKYLLRKAAEG 533 + +M+ +L D M+M++ +E+RVPFLD+ D+ I E+K K LL +A + Sbjct: 470 NMYMQNQLLKDTDFMSMSHGVEVRVPFLDRNFVDLVLSISTEIKFSYEQKKKLLVEAYKE 529 Query: 534 IVPEHVLNRKKLGFPVPIRHWLK 556 +P R K+GF P + W++ Sbjct: 530 DLPVETWKRSKMGFTFPFQEWMR 552 Lambda K H 0.319 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 879 Number of extensions: 49 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 632 Length of database: 595 Length adjustment: 37 Effective length of query: 595 Effective length of database: 558 Effective search space: 332010 Effective search space used: 332010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate CA265_RS01810 CA265_RS01810 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.22142.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-130 422.2 0.1 2.2e-130 422.0 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS01810 CA265_RS01810 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS01810 CA265_RS01810 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.0 0.1 2.2e-130 2.2e-130 1 517 [] 2 543 .. 2 543 .. 0.90 Alignments for each domain: == domain 1 score: 422.0 bits; conditional E-value: 2.2e-130 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsn 67 C iagi+++k+ ++ ++++k+m + ++h GPD++g++ +++ +lg rRLai dls+ +QP+ + lcl|FitnessBrowser__Pedo557:CA265_RS01810 2 CRIAGIINSKNSFEKVNQQVKAMCDSMQHGGPDDHGIYTA-EKTPLCLGNRRLAILDLSSTgHQPMLS 68 99***********9988**********************9.79***************9988*****9 PP TIGR01536 68 ek.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkg 134 +k vi++nGEIYN++++r el++ Gy F+t++DtEViL ay++wge+++e+L+G FAf ++d++++ lcl|FitnessBrowser__Pedo557:CA265_RS01810 69 HKeDLVITYNGEIYNYKQIRTELINLGYIFKTQTDTEVILYAYQHWGETAFEKLDGIFAFCIFDKREQ 136 99999*************************************************************** PP TIGR01536 135 elflaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevke 202 ++l+RD+ GikPLYy +++l faSE+Ka+ +++ i++e d+ + +l++ p++ t k+v lcl|FitnessBrowser__Pedo557:CA265_RS01810 137 CVYLVRDQNGIKPLYYHFANETLTFASEVKAFKHAN-IDQENDN-WRIYYLAFGHIPEPYTTLKNVCS 202 *******************************97776.7777655.556677788779*********** PP TIGR01536 203 lepakal.....dgeekleeywevekeevkeseeelveelrelledavkkrlvadvpvgvllSGGlDS 265 l +++ l + ++ +++y+e e+++ ++e++++e++re l +++k+++++dv +gvl+SGGlDS lcl|FitnessBrowser__Pedo557:CA265_RS01810 203 LGKGSFLkynirSAQHLIQSYHEFESTSYIHNESYAIERIREQLGHSIKQQMISDVDIGVLFSGGLDS 270 ****9998888666777777************************************************ PP TIGR01536 266 slvaaiakkeaksevktFsigfedskdldeskaarkvadelgtehkevliseeevlkeleevilalee 333 s+++ +a+++ ++++ + s +f+ + d++e+k+ + + +++ ++ e li+ ++++++e v+ +++ lcl|FitnessBrowser__Pedo557:CA265_RS01810 271 SIITILANQYNNKQLSSISANFN-EIDFSEKKQRNSLLQKINLQKIEQLITYRDFVQNFETVLADMDQ 337 ***********************.******************************************** PP TIGR01536 334 ptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeealelpease..laekkl... 396 pt+ + i +++++k a+++g+kVvLsG GaDElfgGY f++ ++ ++l+ ++s+ l+++++ lcl|FitnessBrowser__Pedo557:CA265_RS01810 338 PTN--DGINTWFVCKTAKANGIKVVLSGLGADELFGGYPSFDRIHKIQNLN--WLSKsaLRSTRFsnn 401 **5..56889*********************************99999998..333322222222444 PP TIGR01536 397 ..................llqaklakeselkellkakleeelkekeel..kkelkeeseleellrldl 444 l + + + + +ell ++++ + e+ + +k++s+ ++ ++ lcl|FitnessBrowser__Pedo557:CA265_RS01810 402 tkfkrlyylslnspigeyLCLRGVYSPDVIAELLDIDMKTVIDCLEDIplHPGIKKTSNETRASWFEF 469 556777888888887777666667777777777777777766655544003445555888899999** PP TIGR01536 445 elllsdllrak.DrvsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPeeile 511 + ++++ l+ + D +sm h++EvRvPflD+++v+l+lsi +e+k++ +++K lL ea +e lP e + lcl|FitnessBrowser__Pedo557:CA265_RS01810 470 NMYMQNQLLKDtDFMSMSHGVEVRVPFLDRNFVDLVLSISTEIKFSYEQKKKLLVEAYKEDLPVETWK 537 ******************************************************************** PP TIGR01536 512 RkKeaf 517 R+K++f lcl|FitnessBrowser__Pedo557:CA265_RS01810 538 RSKMGF 543 ****99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (595 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 13.25 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory