Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate CA265_RS04615 CA265_RS04615 3-dehydroquinate synthase
Query= curated2:B7GVP5 (360 letters) >FitnessBrowser__Pedo557:CA265_RS04615 Length = 387 Score = 168 bits (425), Expect = 3e-46 Identities = 108/301 (35%), Positives = 160/301 (53%), Gaps = 11/301 (3%) Query: 67 ILPDGEKYK-DIQHLNLIFDALLEAGFNRDCTVLALGGGVIGDMAGFASACFQRGVYFVQ 125 ++P GE+ K D Q+ + + +A+ G +R V A+GGG + DM G+A+ RG+ ++ Sbjct: 83 VIPGGEQVKNDTQYFDRVLEAINVHGIDRHSFVAAIGGGAVLDMVGYAATVAHRGIKHIR 142 Query: 126 VPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVLADMAQLNTLPERELSAGLAEVI 185 +P+T+LSQ DS VG K GIN+ KN LG F P V D L+TL +R+ +G+AE I Sbjct: 143 IPSTVLSQNDSGVGVKNGINYFNKKNFLGTFSPPVAVFNDEVFLSTLSDRDWRSGIAEAI 202 Query: 186 KYALLGDEDFLVWLEENMDGLVARDADLLAEAVYRSCA--HKARIVANDEKEQGERALLN 243 K AL+ D +F WLE N L RD + +++ CA H I + D E G L+ Sbjct: 203 KVALIKDREFFEWLEANATALAQRDITAMNYQIWK-CAKLHLEHIRSADPFENGSARPLD 261 Query: 244 LGHTFGHAIESYLGYGTWLHGEAVATGMVMAADLSQRLGWISNEDVARTKKIIQRANLPI 303 GH H +E YL HGEAVA G+ + A S G IS ED R +I + + Sbjct: 262 FGHWSAHKLE-YLTNFEVRHGEAVAMGIALDAVYSNLSGRISTEDAQRVISLIHQLGFEL 320 Query: 304 SCPQIPLDD----FLGYMAHDKKVLNGQLRLVLLKQLGQAVITKDFDVELMKQA--ILAN 357 + P + + + L + ++ L G+L + LL LG + D +++KQA IL N Sbjct: 321 THPLLQVTEGNSPILQGLEEFREHLGGELTITLLTGLGSGEEVHEIDADILKQAAEILNN 380 Query: 358 Q 358 Q Sbjct: 381 Q 381 Lambda K H 0.321 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 387 Length adjustment: 30 Effective length of query: 330 Effective length of database: 357 Effective search space: 117810 Effective search space used: 117810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory