Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate CA265_RS01880 CA265_RS01880 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >FitnessBrowser__Pedo557:CA265_RS01880 Length = 397 Score = 399 bits (1026), Expect = e-115 Identities = 207/394 (52%), Positives = 275/394 (69%), Gaps = 5/394 (1%) Query: 5 TIRDVDLKGKRVIMRVDFNVPVKDGV-VQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63 TI D K K+ ++RVDFNVP+ D + DD RIRAALPTI L+ G VIL+SHLGRP Sbjct: 3 TIDQFDFKDKKALIRVDFNVPLDDEFKITDDKRIRAALPTISKILKDGGAVILMSHLGRP 62 Query: 64 KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123 K P+ ++SL + LS L+G EVKF +G+ K +LK GEVLLLEN RF+ E Sbjct: 63 KDGPTDKYSLKHILSDLSALVGVEVKFADDCIGESAVKQAADLKSGEVLLLENLRFYKEE 122 Query: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVA--GFLMEKEIKFLSKV 181 K D A+ + L D++VNDAFGTAHRAHAS IAQF P G+LM E++ K+ Sbjct: 123 EKGDVAFAEKLSKLGDVYVNDAFGTAHRAHASTSIIAQFFPDAKYFGYLMASEVENAEKI 182 Query: 182 TYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEED 241 + E+P+ ++GGAKVSDKI +I L++K D ++IGG M +TF KA G E+G+S +E D Sbjct: 183 LNHAERPFTAIMGGAKVSDKILLIEKLLDKVDNLIIGGGMAYTFAKAQGGEIGTSLLEAD 242 Query: 242 KIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETI 301 K +L+ EL+EKAK KGV ++LPVD VIA K +KK V IP WMGLDIGP+++ Sbjct: 243 KQELSLELIEKAKAKGVNLILPVDTVIADKFANDADKKDV-TSGQIPADWMGLDIGPKSV 301 Query: 302 ELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAV 360 LF+ + ++KT++WNGPMGVFE++ F GTK VA A+ A T + GA +++GGGDSAAA+ Sbjct: 302 ALFQDVIKNSKTLLWNGPMGVFEMESFQVGTKAVAEAVVAATKDNGAFSLIGGGDSAAAI 361 Query: 361 NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASI 394 KFG+ED+ S+VSTGGGA LE++EGKELPG+ +I Sbjct: 362 AKFGMEDEVSYVSTGGGALLEYMEGKELPGVKAI 395 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 710 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 397 Length adjustment: 34 Effective length of query: 620 Effective length of database: 363 Effective search space: 225060 Effective search space used: 225060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory