Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate CA265_RS10150 CA265_RS10150 cysteine synthase B
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__Pedo557:CA265_RS10150 Length = 290 Score = 184 bits (468), Expect = 2e-51 Identities = 106/302 (35%), Positives = 170/302 (56%), Gaps = 18/302 (5%) Query: 7 LLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADG 66 ++ +GNTP+ LQ+L+ P VR++AKLE NP GS+KDR ++ MI A G Sbjct: 4 IIDLIGNTPMAELQKLNIN-------PAVRVFAKLEGNNPGGSVKDRASLNMIRSAIERG 56 Query: 67 LLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQI-IFSAA 125 + PG ++E TSGNTGI+LAM A L + VMP N++ ER+ +E +GA++ + + Sbjct: 57 DVVPGTKLVEATSGNTGIALAMIASLYNLEIELVMPANSTRERKVTMEAFGAKVTLLESI 116 Query: 126 EGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGLG 184 E + A E + + +L Q+ NP N +HY TGPE+ D EITHFV+ +G Sbjct: 117 EDCRDYA-----EEKGVSKGYFLLNQFANPDNYLAHYKTTGPEIWRDTEGEITHFVSSMG 171 Query: 185 TTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARYSVGA 244 TTGT+MG RF +E +++I+ +P G + +R E ++P+++DP + + Sbjct: 172 TTGTIMGCSRFFKEKNNDIQIIGCQPTEGSSIPGIRRWPEEYLPKIFDPLRVDRVMDIAQ 231 Query: 245 VDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKYLSTG 304 +A +R + EG+FAG+S+G AAL + + ++ I + D G +YLS+ Sbjct: 232 EEATLMSRRMAKEEGLFAGMSSGGACAAALKLASEL----DKGTIVFIACDRGDRYLSSD 287 Query: 305 AY 306 + Sbjct: 288 LF 289 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 290 Length adjustment: 27 Effective length of query: 296 Effective length of database: 263 Effective search space: 77848 Effective search space used: 77848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory