Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate CA265_RS10150 CA265_RS10150 cysteine synthase B
Query= metacyc::MONOMER-20568 (299 letters) >FitnessBrowser__Pedo557:CA265_RS10150 Length = 290 Score = 247 bits (630), Expect = 3e-70 Identities = 133/291 (45%), Positives = 187/291 (64%), Gaps = 5/291 (1%) Query: 6 ILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLHPGST 65 I++ IGNTP+ + LN NP V+++AKLEG NP GSVKDR +L MI A G + PG+ Sbjct: 4 IIDLIGNTPMAELQKLNINPAVRVFAKLEGNNPGGSVKDRASLNMIRSAIERGDVVPGTK 63 Query: 66 IIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLGTDGAI 125 ++EATSGNTGI LAMI + + +VM + ER+ ++AFGA++ L L + Sbjct: 64 LVEATSGNTGIALAMIASLYNLEIELVMPANSTRERKVTMEAFGAKVTL----LESIEDC 119 Query: 126 RKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTSGTLMG 185 R AE + G YF NQF+N N +AHYKTT EIW T+G +THFV+++GT+GT+MG Sbjct: 120 RDYAEEKGVSKG-YFLLNQFANPDNYLAHYKTTGPEIWRDTEGEITHFVSSMGTTGTIMG 178 Query: 186 VGKNLREKNPEIKIIEAQPTKGHYIQGLKSMEEAIVPAIYQADKIDEHILIESEEAFAKA 245 + +EKN +I+II QPT+G I G++ E +P I+ ++D + I EEA + Sbjct: 179 CSRFFKEKNNDIQIIGCQPTEGSSIPGIRRWPEEYLPKIFDPLRVDRVMDIAQEEATLMS 238 Query: 246 REIVAQEGIFIGMSSGAAMLAAQKLAEKIDSGVIVVLFADRGEKYLSTKLF 296 R + +EG+F GMSSG A AA KLA ++D G IV + DRG++YLS+ LF Sbjct: 239 RRMAKEEGLFAGMSSGGACAAALKLASELDKGTIVFIACDRGDRYLSSDLF 289 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 290 Length adjustment: 26 Effective length of query: 273 Effective length of database: 264 Effective search space: 72072 Effective search space used: 72072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory