Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate CA265_RS05165 CA265_RS05165 hypothetical protein
Query= curated2:Q65PC9 (216 letters) >FitnessBrowser__Pedo557:CA265_RS05165 Length = 211 Score = 55.1 bits (131), Expect = 1e-12 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 10/108 (9%) Query: 66 GIEIHPGAKIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIEDDA 125 G I+ +IG ++ I C + N VT+ GVT+ G + I + Sbjct: 114 GCVINANVRIGNHCIVNSNCN--ISHDCILENYVTISPGVTIAG--------NVHIHEGV 163 Query: 126 LISTGAKVLGSITVGRGAKIGAGSVVLHDVPECSTVVGIPGRVVVQNG 173 I +GA V+ I++G+GA + AG+ V DVP V G+P RV + G Sbjct: 164 FIGSGATVIPGISIGKGAYVAAGACVTKDVPPHVMVAGVPARVKKEVG 211 Lambda K H 0.323 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 211 Length adjustment: 22 Effective length of query: 194 Effective length of database: 189 Effective search space: 36666 Effective search space used: 36666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory