Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate CA265_RS07515 CA265_RS07515 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >FitnessBrowser__Pedo557:CA265_RS07515 Length = 380 Score = 223 bits (568), Expect = 7e-63 Identities = 132/375 (35%), Positives = 208/375 (55%), Gaps = 13/375 (3%) Query: 23 KKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGYVLSNGILECRQAVTRKIKK 82 ++L ++G +I L +G+PDF TP HV +AAKKALDE + Y G + RQA+ K+K Sbjct: 6 RELASKGINIISLSVGEPDFNTPDHVKNAAKKALDENYTRYSPVPGYPDLRQAIVNKLKT 65 Query: 83 LYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTPAFPIYESMINYTGSTPVPYD 142 N D D ++++ G K ++ I +P E+I PTP + Y M+ V D Sbjct: 66 ENNLDYDISQIVVSTGAKQSLSNVILTLIDPDDEVIIPTPYWVSYSEMVTLAEGKSVFID 125 Query: 143 LTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEKSAIDVLAEGLKKHPHVAILS 202 + D K P ++ + IT K++L + +P NPTGS K + L +KHP++ ILS Sbjct: 126 TDIESDFKITPAQLEAAITPKSKLFMFSSPCNPTGSVYSKEELAALVAVFEKHPNIYILS 185 Query: 203 DEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAMTGWRMGWSVWPEELIPHVNKL 262 DEIY + K + + ++DR+I+++G+SKA+AMTGWR+G+ +E+ +KL Sbjct: 186 DEIYEHINFVDKH-ESIAQFDSIKDRVIIVNGFSKAFAMTGWRLGYIAANKEIAAANDKL 244 Query: 263 IINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKLIHEGLNSLPGVECSLPGGAF 322 + S + +Q AGI A + ++ EM F +RR+L++ LN +PGV+ +LP GAF Sbjct: 245 QGQTTSGTCSIAQRAGIVAYEQGLASVLEMKEAFLRRRELVYNLLNEIPGVKTNLPDGAF 304 Query: 323 YAFPKVI----------GTGMNGSEFAKKCMHEAGVAIVPGTAFGKTCQDYVRFSYAASQ 372 Y FP++ + S+ A ++ VA V G +FG +Y+R SYAAS Sbjct: 305 YFFPEISSFFGKKDADGNVIKDSSDLALYLLNVGHVATVGGDSFGN--NNYIRLSYAASD 362 Query: 373 DNISNALENIKKMLG 387 +++ AL IK+ LG Sbjct: 363 ESLVEALRRIKEALG 377 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 380 Length adjustment: 30 Effective length of query: 357 Effective length of database: 350 Effective search space: 124950 Effective search space used: 124950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory