Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate CA265_RS15205 CA265_RS15205 aspartate aminotransferase family protein
Query= SwissProt::Q94AL9 (477 letters) >FitnessBrowser__Pedo557:CA265_RS15205 Length = 378 Score = 197 bits (502), Expect = 4e-55 Identities = 134/387 (34%), Positives = 190/387 (49%), Gaps = 34/387 (8%) Query: 81 LNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVL--YLN 138 L V K Y++D ++++D AGI V N GHCHP VV+ + Q + H V Y+ Sbjct: 2 LEFVRAKGIYIYDAQNKKHIDLIAGIGVSNVGHCHPAVVKAIQEQAETYMHLMVYGEYVQ 61 Query: 139 HAIADFSEALASKLPGDLKVVFFTNSGTEANELALMMAKLYTGCQDIVAVRNGYHGNAAA 198 +F++ALA LP L +F NSGTEA E A+ +AK YTG + +A +N YHG+ Sbjct: 62 TPQVNFAKALADILPESLSCTYFLNSGTEAVEGAMKLAKRYTGRKGFIACKNAYHGS--- 118 Query: 199 TMGATGQSMWKFNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTGHIAGFIC 258 T GA + S ++ P+ DL+ + T IA Sbjct: 119 TQGAES--------LMESDFYSSGYGPFLPHVSFIEHNNLADLEKI-----TNEIAAVFI 165 Query: 259 EAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVVPDIVT 318 E IQG GI Y+ A + G L I DE+QSGF R+G + FE +NVVPD++ Sbjct: 166 EPIQGEAGIRVSDLSYMQALRTKCTETGTLLIFDEIQSGFGRSGKMFAFEHYNVVPDVLL 225 Query: 319 MAKGIGNGFPLGAVVTTPEIAGVLTRR---SYFNTFGGNSVSTTAGLAVLNVIEKEKLQE 375 +AKGIG G P+GA +++ EI VL+ + TFGG+ V AGLA L + + + + Sbjct: 226 LAKGIGGGMPIGAFISSLEIMSVLSHTPILGHMTTFGGHPVCCAAGLATLRTLVDDHIVD 285 Query: 376 NAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKTPATAETLHIMDQMKE 435 G K+ L +H I ++RG+GLML VE + K I+D Sbjct: 286 EVEEKGQLFKQLL-----QHPAIKEIRGKGLMLAVEFENFEINK--------KIIDACIL 332 Query: 436 LGVLIGKGGYFGNVFRITPPLCFTKDD 462 GVL + N RI PPL TK++ Sbjct: 333 DGVLSDWFLHCSNSMRIAPPLIITKEE 359 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 378 Length adjustment: 32 Effective length of query: 445 Effective length of database: 346 Effective search space: 153970 Effective search space used: 153970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory