Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate CA265_RS03620 CA265_RS03620 imidazole glycerol phosphate synthase subunit HisH
Query= CharProtDB::CH_024511 (196 letters) >FitnessBrowser__Pedo557:CA265_RS03620 Length = 210 Score = 158 bits (399), Expect = 7e-44 Identities = 88/195 (45%), Positives = 120/195 (61%), Gaps = 4/195 (2%) Query: 1 MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRER 60 + V I++ G N+ S+ +A+ R + + + +PGVG A AAM++++ Sbjct: 13 LGVGIVNYGAGNIFSLTAALDRLNVTYGMVNTESDLEKYSHIIIPGVGHAGAAMEKLKGT 72 Query: 61 ELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMT-DFGLPLPHMGWN 119 L + IK T+PVLGIC+GMQL+ SEE + LL I+ K + +PHMGWN Sbjct: 73 GLVEAIKKLTKPVLGICVGMQLITEHSEEGDAA-LLNIVPVKTKKFDKSLNIKIPHMGWN 131 Query: 120 RVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNP-WTIAQCNYGEPFTAAVQKDNFYGVQFH 178 V P+ N LF+G+ED FYFVHSY + NP + IA +YG F+AAVQKDNFYGVQFH Sbjct: 132 AVSPK-NNSLFEGVEDNTQFYFVHSYFIEYNPTFDIASADYGLKFSAAVQKDNFYGVQFH 190 Query: 179 PERSGAAGAKLLKNF 193 PE+SG AG +LKNF Sbjct: 191 PEKSGKAGELVLKNF 205 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 210 Length adjustment: 21 Effective length of query: 175 Effective length of database: 189 Effective search space: 33075 Effective search space used: 33075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate CA265_RS03620 CA265_RS03620 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.1802.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-66 209.6 0.1 2.3e-66 209.5 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS03620 CA265_RS03620 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS03620 CA265_RS03620 imidazole glycerol phosphate synthase subunit HisH # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.5 0.1 2.3e-66 2.3e-66 1 197 [. 15 207 .. 15 208 .. 0.95 Alignments for each domain: == domain 1 score: 209.5 bits; conditional E-value: 2.3e-66 TIGR01855 1 ivvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvv 68 +++++yg+gN+ s++ al+r++++ +v+++++lek+ ++++PGVG++ +am+kl+ ++ l+e ++ lcl|FitnessBrowser__Pedo557:CA265_RS03620 15 VGIVNYGAGNIFSLTAALDRLNVTYGMVNTESDLEKYSHIIIPGVGHAGAAMEKLKGTG---LVEAIK 79 78*******************************************************99...55889* PP TIGR01855 69 kkkkpvlgiClGmQllfekseEgkevkglglikgkvkkleaek..kvPhiGWnevevvkesellkgle 134 k +kpvlgiC+GmQl+ e+seEg ++ l +++ k kk++++ k+Ph+GWn v+++++s l++g+e lcl|FitnessBrowser__Pedo557:CA265_RS03620 80 KLTKPVLGICVGMQLITEHSEEG-DAALLNIVPVKTKKFDKSLniKIPHMGWNAVSPKNNS-LFEGVE 145 **********************7.579*************99999********99876665.****** PP TIGR01855 135 eearvYfvHsYaveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknfle 197 +++++YfvHsY +e + +a+adyg kf aav+kdn++gvQFHPEkSgk+G +lknf + lcl|FitnessBrowser__Pedo557:CA265_RS03620 146 DNTQFYFVHSYFIEYNP-TFDIASADYGLKFSAAVQKDNFYGVQFHPEKSGKAGELVLKNFSN 207 ****************8.7999**************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (210 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory