GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuC in Pedobacter sp. GW460-11-11-14-LB5

Align 3-isopropylmalate dehydratase large subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate CA265_RS16405 CA265_RS16405 aconitate hydratase

Query= curated2:O28084
         (416 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS16405 CA265_RS16405 aconitate
           hydratase
          Length = 759

 Score =  184 bits (468), Expect = 6e-51
 Identities = 141/450 (31%), Positives = 205/450 (45%), Gaps = 49/450 (10%)

Query: 4   TIAEKIL------SEKSKSDAYAGDIVVAEIDQIALQDGTAPLAIRQLMELGTEVRAADR 57
           T++EKIL       +   +     D V    D++A+QD TA +A+ Q M+ G    A   
Sbjct: 31  TLSEKILYAHLWDGDPKTAFKRGSDYVDFAPDRVAMQDATAQMALLQFMQAGRPQVAVPS 90

Query: 58  THFFVDHAA----------PSPRRELSNDQKFIYEFAKKVGADFNPPGEGIIHQIMVERY 107
           T    DH            P  + E +    F+   + K G  F  PG GIIHQ+++E Y
Sbjct: 91  T-VHCDHLITAKEGAAIDLPHAKTESAEVFDFLSSVSNKYGIGFWKPGAGIIHQVVLENY 149

Query: 108 VKPGDLAVGADSHTCTYGGIGAFSTGMGSTDVAVAIALGKNW-FRVPESFRVQLDGSLPK 166
             PG + +G DSHT   GG+G  + G+G  D A  +  G  W  + P+   V+L G L  
Sbjct: 150 AFPGGMMIGTDSHTVNAGGLGMVAIGVGGAD-ACDVMAGLPWELKFPKLIGVKLTGKLNG 208

Query: 167 GVFAKDVILKLIGDLGVDGATYKALEFHGECAENMTVEERLTIANMAVECGAKAGIFESD 226
              AKDVILK+ G L V G T   +E+ G+ A +M+   + TI NM  E GA    F  D
Sbjct: 209 WTAAKDVILKVAGILTVKGGTGAIVEYFGDGATSMSCTGKGTICNMGAEIGATTSTFGYD 268

Query: 227 ENTRKFLAELGRE--------------GDFREVKADEDAEYEKEIYMDVSSLVPVVSKPH 272
           E+  ++L   GR               GD  EV AD +  +++ I +D+ +L P ++ P 
Sbjct: 269 ESMERYLRATGRNEVADEANKIAAYLTGD-AEVYADPENYFDQVIEIDLDTLEPYLNGPF 327

Query: 273 NVDNVAEISEVE--------GTEVNQVYIGTCTNGRLSDLEVAARILKGRKVKEGVRLI- 323
             D    +S+++          +V    IG+CTN    DL  AA I      K  V    
Sbjct: 328 TPDLATPVSQMKVEAEKNGWPLKVEWGLIGSCTNSSYEDLSRAASIANQAIAKGLVTKAD 387

Query: 324 --VVPASRRVYLQALDKGLIRVFVEAGGMVLNPGCGPCVGIHQ---GILADGEVCISTQN 378
             + P S +V   A   G ++ F +    +    CGPC+G+        A+    + + N
Sbjct: 388 FGINPGSEQVRYTADRDGFLKTFEDLNATIFTNACGPCIGMWDRTGAEKAEKNTIVHSFN 447

Query: 379 RNFKGRM-GNPNAEIFLASPATAAASAVKG 407
           RNF  R  GNPN   F+ASP   AA A+ G
Sbjct: 448 RNFAKRADGNPNTFAFVASPEMVAAIAISG 477


Lambda     K      H
   0.318    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 710
Number of extensions: 40
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 416
Length of database: 759
Length adjustment: 36
Effective length of query: 380
Effective length of database: 723
Effective search space:   274740
Effective search space used:   274740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory