Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (characterized)
to candidate CA265_RS15205 CA265_RS15205 aspartate aminotransferase family protein
Query= SwissProt::P40732 (405 letters) >FitnessBrowser__Pedo557:CA265_RS15205 Length = 378 Score = 202 bits (513), Expect = 2e-56 Identities = 125/383 (32%), Positives = 195/383 (50%), Gaps = 21/383 (5%) Query: 29 VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTS--NVFTNEPA 86 V+ KG ++D Q K++ID GI V+ +GHCHPA+V+A++ Q ET H + P Sbjct: 5 VRAKGIYIYDAQNKKHIDLIAGIGVSNVGHCHPAVVKAIQEQAETYMHLMVYGEYVQTPQ 64 Query: 87 LRLGRKLIDAT--FAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGR 144 + + L D F+NSGTEA E A KLA+ Y + IA NA+HG Sbjct: 65 VNFAKALADILPESLSCTYFLNSGTEAVEGAMKLAKRYTG------RKGFIACKNAYHGS 118 Query: 145 SLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAA 204 + S+ YS G+GP + + N+L ++ + ++ AV +EPIQGE G++ + Sbjct: 119 TQGAESLMESDFYSSGYGPFLPHVSFIEHNNLADLEKITNE-IAAVFIEPIQGEAGIRVS 177 Query: 205 TPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVS 264 +++ LR C E LL+FDE+Q G GR+G +FA+ HY V PD+L AK +GGG P+ Sbjct: 178 DLSYMQALRTKCTETGTLLIFDEIQSGFGRSGKMFAFEHYNVVPDVLLLAKGIGGGMPIG 237 Query: 265 AMLTTQEIASAFH---VGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQH 321 A +++ EI S + H +T+GG+P+ CA A + ++ + K Q F Q Sbjct: 238 AFISSLEIMSVLSHTPILGHMTTFGGHPVCCAAGLATLRTLVDDHIVDEVEEKGQLFKQL 297 Query: 322 LQAIDEQFDIFSDIRGMGLLIGAELKP-KYKGRARDFLYAGAEAGVMVLNAGADVMRFAP 380 L Q +IRG GL++ E + + + D L+ ++ MR AP Sbjct: 298 L-----QHPAIKEIRGKGLMLAVEFENFEINKKIIDACILDGVLSDWFLHC-SNSMRIAP 351 Query: 381 SLVVEEADIHEGMQRFAQAVGKV 403 L++ + +I E + V V Sbjct: 352 PLIITKEEIAEACTIILKNVNSV 374 Lambda K H 0.322 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 378 Length adjustment: 31 Effective length of query: 374 Effective length of database: 347 Effective search space: 129778 Effective search space used: 129778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory