Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (uncharacterized)
to candidate CA265_RS18530 CA265_RS18530 aspartate aminotransferase family protein
Query= curated2:P59317 (406 letters) >FitnessBrowser__Pedo557:CA265_RS18530 Length = 382 Score = 211 bits (537), Expect = 3e-59 Identities = 135/394 (34%), Positives = 206/394 (52%), Gaps = 25/394 (6%) Query: 17 ILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWH 76 + +Y + K GS +WD ++Y+D GG AV ++GH +P VN L Q + Sbjct: 3 LFDVYPLNDIEITKAAGSNVWDANDQQYLDLYGGHAVISIGHTNPHYVNRLTDQLNKVGF 62 Query: 77 ISNVFTNEPALRLGRKLIEATFAE--RVVFMNSGTEANETAFKLARHYACVRHSPFKTKI 134 SN ++L KL E + + ++ NSG EANE A KLA Y + K+ Sbjct: 63 YSNSVKIPLQVQLAEKLGEVSGKKDFQLFLCNSGAEANENALKLASFYNG------RKKV 116 Query: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMD---DHTCAVV 191 IAF AFHGR+ V+V PK + ++I +PFN+ A++ + AV+ Sbjct: 117 IAFTGAFHGRTSLAVAVTDNPKIVAPVN-QTENVIFLPFNNEIALEETFKAQGNEISAVI 175 Query: 192 VEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDIL 251 +E IQG GG+ A+ FLQ +R LCD++ A+ + D VQCG GRTG +++ + GV D+ Sbjct: 176 IEGIQGVGGIKEASKSFLQKIRSLCDEYNAVYIADSVQCGYGRTGSFYSHDYSGVEADVY 235 Query: 252 TSAKALGGGFPVSAMLTTAEIASAFHP--GSHGSTYGGNPLACAVAGAAFDIINTPEVLE 309 T AK +G GFPV+ + IAS F P G G+T+GGN LACA A A +++ +++ Sbjct: 236 TMAKGMGNGFPVAGI----SIASKFKPWHGELGTTFGGNHLACAAALAVLEVMEKDNLIK 291 Query: 310 GIQAKRQHFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGRARDFLYAGAEEGVMVL 369 + + + L+K +Q +V RG GL+IG EL + ++ L+ + Sbjct: 292 NAEEVGNYLIAELKKFEQVVEV----RGRGLMIGIELPAELAHVKKELLFT---HHIFTG 344 Query: 370 NAGPDVMRFAPSLVVEDADIDEGMHRFAHAVAKV 403 A P+V+R P+L + A DE + F AV V Sbjct: 345 EAKPNVIRLLPALNLTKAHADEFLAAFEKAVKGV 378 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 23 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 382 Length adjustment: 31 Effective length of query: 375 Effective length of database: 351 Effective search space: 131625 Effective search space used: 131625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory