Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate CA265_RS18195 CA265_RS18195 maltose O-acetyltransferase
Query= curated2:Q9K9H8 (240 letters) >FitnessBrowser__Pedo557:CA265_RS18195 Length = 200 Score = 60.5 bits (145), Expect = 2e-14 Identities = 44/127 (34%), Positives = 62/127 (48%), Gaps = 18/127 (14%) Query: 104 VEIGDN------AVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGV 157 +EIGDN VI+ A + IG+ + I NV + T G H Sbjct: 75 IEIGDNFYANFNLVILDCAKVRIGNSV----FIAPNVAI---YTAGHPIHAHLRDQ---- 123 Query: 158 IEPPSAKPVVVEDDVVIGANCVILEGVTVGKGAVVAAGAVVTEDVPPNTVVAGTPARVIK 217 E A+ V + + V IG N VI GVT+G V+ +G+VVT D+P N AG P RVI+ Sbjct: 124 -EYEWAQEVSIGNSVWIGGNVVINPGVTIGSNVVIGSGSVVTRDIPDNVFAAGNPCRVIR 182 Query: 218 EIDEKTK 224 ++ + K Sbjct: 183 QLTDADK 189 Score = 26.6 bits (57), Expect = 4e-04 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 100 IRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNV 134 I + V IG N VI G +I VIG G+++ ++ Sbjct: 133 IGNSVWIGGNVVINPGVTIGSNVVIGSGSVVTRDI 167 Lambda K H 0.314 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 200 Length adjustment: 22 Effective length of query: 218 Effective length of database: 178 Effective search space: 38804 Effective search space used: 38804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory