Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate CA265_RS09650 CA265_RS09650 diaminopimelate decarboxylase
Query= reanno::Btheta:350902 (386 letters) >FitnessBrowser__Pedo557:CA265_RS09650 Length = 390 Score = 417 bits (1073), Expect = e-121 Identities = 214/386 (55%), Positives = 271/386 (70%), Gaps = 9/386 (2%) Query: 7 IDKFRTLQTPFYYYDTKVLRDTLSAINQEVAKYPSYSVHYAVKANANPKVLTIIRESGMG 66 I KF ++TPFYYYDT +L+ TL A Y + +HYA+KAN N +L I+E G G Sbjct: 7 ISKFNNIETPFYYYDTDLLQKTLRTCADAAAPY-QFHIHYALKANFNSVLLNQIKEIGFG 65 Query: 67 ADCVSGGEIRAAVRAGFPANKIVFAGVGKADWEINLGLEYGIFCFNVESIPELEVINELA 126 ADCVS GE+R AV GF KIVFAGVGK+D EIN L+ IFCFNVESI ELEV+NELA Sbjct: 66 ADCVSAGEVRRAVEVGFDHKKIVFAGVGKSDKEINEALDLDIFCFNVESIQELEVLNELA 125 Query: 127 AAQNKIANVAFRINPDVGAHTHANITTGLAENKFGISMQDMDRVIDVALEMKNVKFIGLH 186 + K A VA RINP+V AHTH NITTGL ENKFGI+ D+ D N+KFIG+H Sbjct: 126 GKKGKTAQVAIRINPNVDAHTHHNITTGLDENKFGINSWDLPECADTLKASPNLKFIGIH 185 Query: 187 FHIGSQILDMGDFIALCNRVNELQDKLEARRILVEHINVGGGLGIDYGHPNRQSVPDFKS 246 FHIGSQI ++ + LC RVNE E + ++ +NVGGGLGIDY +P+ Q +PDFKS Sbjct: 186 FHIGSQITNLDVYKNLCVRVNEFAAWFEDKGFNLQVLNVGGGLGIDYHNPDHQ-IPDFKS 244 Query: 247 YFATYAGQLKLRPYQTLHFELGRAVVGQCGSLISKVLYVKQGTKKKFAILDAGMTDLIRP 306 YF ++ L ++P Q +HFELGRA+VGQ SLI++VLY+K G KK F +LDAGMT+L+RP Sbjct: 245 YFKIFSEFLTVKPGQEVHFELGRALVGQSASLITRVLYIKNGKKKNFVVLDAGMTELMRP 304 Query: 307 ALYQAYHKMENITSEEPVEA-------YDVVGPICESSDVFGKAIDLNKVKRGDLIALRS 359 ALYQAYHK+EN++ + V + YD+VGPICES+D FGK ++ + RGD+ A+RS Sbjct: 305 ALYQAYHKIENLSRKSEVGSPESTALKYDIVGPICESTDCFGKEVEQPESFRGDIFAIRS 364 Query: 360 AGAYGEIMASGYNCRELPKGYTSDEL 385 AGAYGE+MAS YN R+ + S E+ Sbjct: 365 AGAYGEVMASKYNLRDAIRSVYSSEI 390 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 390 Length adjustment: 30 Effective length of query: 356 Effective length of database: 360 Effective search space: 128160 Effective search space used: 128160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS09650 CA265_RS09650 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.29606.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-123 398.0 0.0 2.5e-123 397.6 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS09650 CA265_RS09650 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS09650 CA265_RS09650 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.6 0.0 2.5e-123 2.5e-123 22 393 .. 12 385 .. 5 389 .. 0.94 Alignments for each domain: == domain 1 score: 397.6 bits; conditional E-value: 2.5e-123 TIGR01048 22 efgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgGElerala 89 + tP+Y yd++ l++ l++ + a + ++ ++YA+KAn n +l+ ++e G+g+d+vs GE+ ra++ lcl|FitnessBrowser__Pedo557:CA265_RS09650 12 NIETPFYYYDTDLLQKTLRTCADAAAPYQFHIHYALKANFNSVLLNQIKEIGFGADCVSAGEVRRAVE 79 678**********************99988************************************** PP TIGR01048 90 AgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdakth 157 g++ +kivf+g+gks++e+++al+l+i ++nv+s++ele l+e+a++ gk+a+v++R+np+vda+th lcl|FitnessBrowser__Pedo557:CA265_RS09650 80 VGFDHKKIVFAGVGKSDKEINEALDLDIFCFNVESIQELEVLNELAGKKGKTAQVAIRINPNVDAHTH 147 ******************************************************************** PP TIGR01048 158 eyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkee 225 i+TGl e+KFGi+ + e + + +++++l+ +Gih+HIGSqi++l+ +++ + +v ++++ ++++ lcl|FitnessBrowser__Pedo557:CA265_RS09650 148 HNITTGLDENKFGINSWDLPECADTLKASPNLKFIGIHFHIGSQITNLDVYKNLCVRVNEFAAWFEDK 215 ******************************************************************** PP TIGR01048 226 gieleeldlGGGlgisyee.eeeapdleeyaeklleklekeaelglklklilEpGRslvanagvlltr 292 g++l++l++GGGlgi+y++ +++ pd ++y + + e l+ + +++ +E GR+lv++++ l+tr lcl|FitnessBrowser__Pedo557:CA265_RS09650 216 GFNLQVLNVGGGLGIDYHNpDHQIPDFKSYFKIFSEFLTV----KPGQEVHFELGRALVGQSASLITR 279 *****************87255678888888887766665....57999******************* PP TIGR01048 293 VesvKevesrkfvlvDagmndliRpalYeayheiaalkr.....leeeetetvdvvGplCEsgDvlak 355 V ++K+ ++++fv+ Dagm++l+RpalY+ayh+i +l+r e ++ ++d+vGp+CEs D ++k lcl|FitnessBrowser__Pedo557:CA265_RS09650 280 VLYIKNGKKKNFVVLDAGMTELMRPALYQAYHKIENLSRksevgSPESTALKYDIVGPICESTDCFGK 347 *************************************9955544445667899*************** PP TIGR01048 356 drelpeveeGdllavasaGAYgasmssnYnsrprpaev 393 ++e pe +Gd+ a++saGAYg m+s+Yn r ++ v lcl|FitnessBrowser__Pedo557:CA265_RS09650 348 EVEQPESFRGDIFAIRSAGAYGEVMASKYNLRDAIRSV 385 *******************************9988777 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory