Align Homoserine O-succinyltransferase; HST; EC 2.3.1.46; Homoserine transsuccinylase; HTS (uncharacterized)
to candidate CA265_RS08175 CA265_RS08175 homoserine O-acetyltransferase
Query= curated2:A1SMU5 (369 letters) >FitnessBrowser__Pedo557:CA265_RS08175 Length = 352 Score = 186 bits (471), Expect = 1e-51 Identities = 107/346 (30%), Positives = 179/346 (51%), Gaps = 24/346 (6%) Query: 24 LRGGGRLDHVEVAYETYGSLSPARDNAVFICHALTGDAHAAGLHVGSKKRGWWDNLIGPG 83 L G ++ ++++AY+TYG L+ +DN +++CHALT +A WW+ L G Sbjct: 15 LESGKKIRNLQIAYQTYGKLNANKDNVIWVCHALTANADVFE---------WWEGLFGQN 65 Query: 84 KPVDTDRFFVISANLLGGCSGSTGPLSTDPATGAPYCLDFPMLHMSDLVAAHRRLVAHLG 143 + + +++ AN+LG GS+ PLST+P TG PY L FP + DLV+AH+ L +HLG Sbjct: 66 SLFNPEEHYIVCANVLGSHYGSSNPLSTNPVTGLPYYLSFPQFTIRDLVSAHQLLASHLG 125 Query: 144 IERLHAAVGGSLGGMQVLQWVIDEPDALERAVLVAASSRLSPENIAFSAIGREAIMSDPD 203 I+ + +GGSLGG Q ++W I EP+ +E +L+A ++ SP IAF+ R AI +D Sbjct: 126 IDYIKLLIGGSLGGQQAVEWSISEPNKIENLILIATNAAHSPWGIAFNESQRLAITTDRT 185 Query: 204 FCNGRYVEQGVFPWRGQKVARMMAHITYVSAQSLETKFGHRRRSRGDAWTLGPDYEVEHY 263 F Y Q +G K AR +A ++Y + + + + D ++ Y Sbjct: 186 F----YANQPNGGSKGLKTARSIALLSYRTYSAYGSTQVESVNDKTD------NFRSSSY 235 Query: 264 LQHQGQVFLGRFDALSYLYLTRLLDYFDPFAD-PGTAAALRSTATRFQLTSFDSDWRFDS 322 +QG+ + RF+A SY YLT+ +D + + A AL+ + ++D F Sbjct: 236 QNYQGEKLINRFNAYSYYYLTKAMDSHNVGRNRKSIADALKLITANTLVIGIENDVLFPL 295 Query: 323 TQSARMTAELKALGVAVDWAELASPFGHDSFLLQPPGYHERIAEFL 368 ++ + + +++ L S +GHD FL++ I F+ Sbjct: 296 SEQKYLADHIP----GAEFSALHSDYGHDGFLIETDALTNVIGNFI 337 Lambda K H 0.322 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 352 Length adjustment: 29 Effective length of query: 340 Effective length of database: 323 Effective search space: 109820 Effective search space used: 109820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory