Align Cystathionine beta-lyase; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 (characterized)
to candidate CA265_RS06375 CA265_RS06375 cystathionine gamma-synthase
Query= SwissProt::Q83A83 (387 letters) >FitnessBrowser__Pedo557:CA265_RS06375 Length = 379 Score = 429 bits (1104), Expect = e-125 Identities = 207/376 (55%), Positives = 275/376 (73%), Gaps = 3/376 (0%) Query: 13 TRVIHAGQKPDPLTGAVMTPIYTASTYAQKSPGVHQGYEYSRSQNPTRFAYERCVADLES 72 T+ IHAGQ+PDP TGAVMTPIY STY QKSPG ++GYEYSR NPTR A E C+A LE+ Sbjct: 5 TKAIHAGQEPDPTTGAVMTPIYQTSTYWQKSPGDNKGYEYSRGTNPTRKALEDCLAALEN 64 Query: 73 GQHGFAFASGMAATATILELLQPGDHVVVMDDVYGGSYRLFENVRKRSAGLSFSFVDFTD 132 ++G AF+SGM AT +L+LLQPGD V+ +D+YGGSYR+F + + G+ F F+D + Sbjct: 65 AKYGLAFSSGMGATDAVLKLLQPGDEVITGNDLYGGSYRIFTKIFTK-YGIKFHFLDLSK 123 Query: 133 ENKVREAVTAKTKMLWVESPSNPRLKIVDLAKIAEIAKEKNIIAVADNTFATPIIQRPLE 192 + + KTK++W+E+P+NP ++I+D+ +A+I KEKN+I DNTFA+P +Q P++ Sbjct: 124 PENILPYINDKTKLVWIETPTNPTMQIIDIEGVAKITKEKNLILTVDNTFASPYLQNPID 183 Query: 193 LGFDIVTHSATKYLNGHSDIIGGVAVVGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGL 252 LG DIV HS TKY+ GHSD++ G V D + L + L ++ NA GA P D+F+VLRG+ Sbjct: 184 LGADIVMHSVTKYIGGHSDVVMGALVTNDEQ-LYKDLWFIYNACGATPGPQDAFLVLRGI 242 Query: 253 KTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLPSHPQHSIAKKQMRYFGGMISVELK 312 KTL +RM+ HCEN ++A +L+ HPKV ++Y+PG HP H IAKKQMR FGGMIS+ LK Sbjct: 243 KTLHLRMKAHCENGERIAHYLKTHPKVDKIYWPGFEDHPNHDIAKKQMRGFGGMISITLK 302 Query: 313 -CDLNETKKVLERCQLFTLAESLGGVESLIEHPAIMTHASIPQAERQKLGITDGFIRLSV 371 DL ET ++ ++FTLAESLGGVESLI HPA MTH SIP+ ER+K+G+TD +RLSV Sbjct: 303 GADLEETFRISSNFKVFTLAESLGGVESLINHPATMTHGSIPKEEREKVGVTDNLLRLSV 362 Query: 372 GIEAITDLRHDLEAAL 387 G+E I DL DL AL Sbjct: 363 GVEDIDDLLEDLANAL 378 Lambda K H 0.319 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 379 Length adjustment: 30 Effective length of query: 357 Effective length of database: 349 Effective search space: 124593 Effective search space used: 124593 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory