Align aspartate transaminase; EC 2.6.1.1 (characterized)
to candidate CA265_RS11675 CA265_RS11675 aspartate aminotransferase
Query= CharProtDB::CH_004890 (393 letters) >FitnessBrowser__Pedo557:CA265_RS11675 Length = 399 Score = 171 bits (434), Expect = 3e-47 Identities = 117/405 (28%), Positives = 204/405 (50%), Gaps = 27/405 (6%) Query: 2 KLAKRVSALTPSTTLAITAKAKELKAAGHDVIGLGAGEPDFNTPQHIIDAAVRSMNEGHT 61 K++++ + S +T A + K G V L G+PD TP+ +++A +++++ Sbjct: 3 KISQKGVQMPASPIRKLTPFADQAKKDGKKVFHLNIGQPDIETPEGMLNA-IKNIDFNVW 61 Query: 62 KYTPSGGLAELKNSIAEKFKRDQNIEYKPSQIIVCTGAKHALYTLFQVILDEEDEVIIPT 121 YTPS G + + E + + P I+V G A+ Q ++E DE+IIP Sbjct: 62 AYTPSEGTLAYRLKLTEYYNK-LGYNITPENILVTVGGSEAITIAMQTCVNEGDEIIIPE 120 Query: 122 PYWVSYPEQVKLAGGKPVYVEGLEENHFKISP-EQLKNAITEKTKAIVINSPSNPTGVMY 180 P++ +Y ++ + EN F + P + + ITEKTKAI+I +P+NPTG +Y Sbjct: 121 PFYANYNGFACMSNVVVKPILSYIENGFALPPIAEFEKLITEKTKAIIICNPNNPTGYLY 180 Query: 181 TEEELSALGEVCLEHDILIVSDEIYEKLTYGGKKHVSIAQLSDRLKEQTVIINGVSKSHS 240 + EL AL +C+++D+ + SDE Y + Y G++ +S L D L E VI++ VSK +S Sbjct: 181 SRAELEALKTLCVKYDLFLFSDEAYREFCYDGREFISPMHL-DGLDENVVIMDTVSKRYS 239 Query: 241 MTGWRIGYAAGSEDIIKAMTNLASHSTSNPTSIAQYGAIAAYNGPSEPLEEMREAFEHRL 300 G R+G + A + + +P + Q AA + P E++ + R Sbjct: 240 ACGARLGCLITKNKEVIASGLKFAQARLSPGMVEQIAGAAAVDTPDSYFEKVNTEYTLRR 299 Query: 301 NTIYAKLIEIPGFSCVKPEGAFYL---FPNAKEAAQSCGFKDVDEFVKALLEE-----EK 352 +T+ +L +I G C P GAFY+ FP D D+F + +LE+ + Sbjct: 300 DTLVGRLNQIEGVFCPNPGGAFYVVAKFP----------IDDADQFCQWILEDFNHNNQT 349 Query: 353 VAIVPGSGF----GSPEN-VRLSYATSLDLLEEAIERIKRFVEKH 392 V + P +GF GS +N VR++Y + D L A++ ++ ++++ Sbjct: 350 VMMAPATGFYSTPGSGKNEVRMAYVLNTDDLNAAMDCLEVALQQY 394 Lambda K H 0.313 0.131 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 399 Length adjustment: 31 Effective length of query: 362 Effective length of database: 368 Effective search space: 133216 Effective search space used: 133216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory