GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argB in Pedobacter sp. GW460-11-11-14-LB5

Align Acetylglutamate kinase; EC 2.7.2.8; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK (uncharacterized)
to candidate CA265_RS18510 CA265_RS18510 acetylglutamate kinase

Query= curated2:A6L013
         (257 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS18510 CA265_RS18510
           acetylglutamate kinase
          Length = 278

 Score =  275 bits (703), Expect = 7e-79
 Identities = 145/266 (54%), Positives = 189/266 (71%), Gaps = 17/266 (6%)

Query: 1   MKEK-LTIIKVGGKIVEEESTLNQLLADFSAIEGYKLLVHGGGRSATRLAAQLGIESKMV 59
           MK K LTIIK+GG +++    L+Q L DF+A+ G K+LVHGGG+ AT L   LGIE+KM+
Sbjct: 1   MKNKQLTIIKIGGNVIDNSENLHQFLLDFTALPGDKILVHGGGKIATELGESLGIEAKMI 60

Query: 60  NGRRITDAETLKVVTMVYGGLVNKNIVAGLQAKGVNAIGLTGADMNVIRSVKRPV----- 114
           +GRRITD ETL++VTMVY GL+NKN+VA LQAKG NAIGL+GAD NVIR+ KRPV     
Sbjct: 61  DGRRITDIETLRIVTMVYAGLINKNMVAQLQAKGSNAIGLSGADGNVIRAKKRPVITKTY 120

Query: 115 ---------KDVDYGFVGDVEK--VNAGFLAALIRQGIVPVMAPLTHDGKGSMLNTNADT 163
                      +DYGFVGD+++  V++  L +L++ G+VPV+  +THDG   +LNTNADT
Sbjct: 121 GAESGPMAGAVIDYGFVGDLDENAVSSTTLESLLKAGLVPVLCAITHDGDTQLLNTNADT 180

Query: 164 IAGETAKALASLFDVTLVYCFEKKGVLRDENDDDSVIPVITPEEFKEFVAQGIIQGGMIP 223
           IA   A A+++L++  LVYCFEKKGVL++ NDD SV+  I  +EF+   A G +QGGMIP
Sbjct: 181 IASSVAVAMSALYETRLVYCFEKKGVLKNVNDDGSVVREIKADEFEGLKADGTVQGGMIP 240

Query: 224 KLENSFSAIDAGVSQVVITLASAINE 249
           KL N+F AI  GVS V I  A  + E
Sbjct: 241 KLHNAFEAIKKGVSAVYIGKADELAE 266


Lambda     K      H
   0.316    0.135    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 248
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 257
Length of database: 278
Length adjustment: 25
Effective length of query: 232
Effective length of database: 253
Effective search space:    58696
Effective search space used:    58696
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate CA265_RS18510 CA265_RS18510 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00761.hmm
# target sequence database:        /tmp/gapView.4327.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00761  [M=231]
Accession:   TIGR00761
Description: argB: acetylglutamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
    2.4e-60  189.9   3.7    2.7e-60  189.8   3.7    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS18510  CA265_RS18510 acetylglutamate ki


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS18510  CA265_RS18510 acetylglutamate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  189.8   3.7   2.7e-60   2.7e-60       2     231 .]       7     258 ..       6     258 .. 0.95

  Alignments for each domain:
  == domain 1  score: 189.8 bits;  conditional E-value: 2.7e-60
                                  TIGR00761   2 iViKiGGaaiselleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlev 69 
                                                 +iKiGG++i++ +e+l + +  + +     ++vHGGg+  +el e lgie ++++g R+Td etl +
  lcl|FitnessBrowser__Pedo557:CA265_RS18510   7 TIIKIGGNVIDN-SENLHQFLLDFTALPGDKILVHGGGKIATELGESLGIEAKMIDGRRITDIETLRI 73 
                                                69*********6.999999999999998888************************************* PP

                                  TIGR00761  70 vemvligkvnkelvallekhgikavGltgkDgqlltae...kldke.............dlgyvGeik 121
                                                v+mv++g +nk++va+l+ +g +a+Gl+g+Dg+++ a+    ++k              d+g+vG+++
  lcl|FitnessBrowser__Pedo557:CA265_RS18510  74 VTMVYAGLINKNMVAQLQAKGSNAIGLSGADGNVIRAKkrpVITKTygaesgpmagaviDYGFVGDLD 141
                                                **************************************887666668899***************996 PP

                                  TIGR00761 122 ..kvnkelleallkagiipviaslaldeegqllNvnaDtaAaelAaaleA...ekLvlLtdvaGileg 184
                                                  +v+   le+llkag +pv+ ++  d + qllN+naDt+A+ +A a+ A    +Lv+  +++G+l++
  lcl|FitnessBrowser__Pedo557:CA265_RS18510 142 enAVSSTTLESLLKAGLVPVLCAITHDGDTQLLNTNADTIASSVAVAMSAlyeTRLVYCFEKKGVLKN 209
                                                2369*****************************************9999955458************* PP

                                  TIGR00761 185 ..dkksliseleleeieqlikqavikgGmipKveaalealesgvkkvvi 231
                                                  d  s+++e++++e e l   + ++gGmipK+++a ea+++gv++v i
  lcl|FitnessBrowser__Pedo557:CA265_RS18510 210 vnDDGSVVREIKADEFEGLKADGTVQGGMIPKLHNAFEAIKKGVSAVYI 258
                                                998889***************************************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (231 nodes)
Target sequences:                          1  (278 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 6.34
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory