GapMind for Amino acid biosynthesis

 

Aligments for a candidate for proC in Pedobacter sp. GW460-11-11-14-LB5

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate CA265_RS18505 CA265_RS18505 pyrroline-5-carboxylate reductase

Query= curated2:P74572
         (267 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS18505 CA265_RS18505
           pyrroline-5-carboxylate reductase
          Length = 269

 Score =  133 bits (334), Expect = 5e-36
 Identities = 90/268 (33%), Positives = 146/268 (54%), Gaps = 7/268 (2%)

Query: 4   QLGIIGGGVMAEAILARLIAEKTYAPEEIIVGEPHGARR-DYLQKTYQVRVSPDNQEAAN 62
           ++ IIG G +  ++   L+       + II+   + A    + Q+ Y  +V+ +N +AA 
Sbjct: 3   KIAIIGSGNIGLSLAKGLVKANYTTTKNIILTRRNTANLYKFAQERY--KVTANNADAAA 60

Query: 63  VSEVLLLAVKPQVLDRVLASLAGGAN--RPLVISILAGVSLQRIQKGFPDHA-IIRAMPN 119
            ++V++LAV PQ L+ VL  +    N  + LVIS+++GVS   +++    +  IIRAMPN
Sbjct: 61  DADVIILAVLPQQLNVVLEEIQSAINPAKHLVISVISGVSCAAVREKLDSNVQIIRAMPN 120

Query: 120 TPATVGAGMTAIAANKMVEPDQLAKAKAIFSAVGNVVEVPENLMDAVTGVSGSGPAYVAL 179
           T   +G  MT IA++    P  L     +F  VG+VV++ E+LM + T +   G A+   
Sbjct: 121 TAIAIGQSMTCIASDN-ASPQNLEDVTRMFETVGSVVKINEDLMTSATALCACGIAFFLR 179

Query: 180 MIEALADGGVLAGLPRAIAQKLALQTVLGTAELIKETEEHPAQIKDKVTSPGGTTIAGVA 239
            I A + GGV  G     A K+A+QT  G A+L+     HP    DKVTSP G TIAG+ 
Sbjct: 180 GIRAASQGGVEIGFHADEALKMAVQTAKGAADLLLLHGTHPESEIDKVTSPKGCTIAGLN 239

Query: 240 VLEKMGFRSAIIEAVRAAYRRSQELGKK 267
            +E  G+ S++I+ ++ +  ++  L  K
Sbjct: 240 EMEHNGYSSSLIKGIKLSALKAGNLYTK 267


Lambda     K      H
   0.316    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 149
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 267
Length of database: 269
Length adjustment: 25
Effective length of query: 242
Effective length of database: 244
Effective search space:    59048
Effective search space used:    59048
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate CA265_RS18505 CA265_RS18505 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00112.hmm
# target sequence database:        /tmp/gapView.21892.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
    3.5e-70  222.6   6.6    3.9e-70  222.5   6.6    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS18505  CA265_RS18505 pyrroline-5-carbox


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS18505  CA265_RS18505 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.5   6.6   3.9e-70   3.9e-70       1     261 [.       4     262 ..       4     264 .. 0.96

  Alignments for each domain:
  == domain 1  score: 222.5 bits;  conditional E-value: 3.9e-70
                                  TIGR00112   1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavK 68 
                                                iaiiG Gn+g +l++gl+k++  + k+i++++r++++l ++a+e   +vt++++ a+++adv++lav 
  lcl|FitnessBrowser__Pedo557:CA265_RS18505   4 IAIIGSGNIGLSLAKGLVKANYTTTKNIILTRRNTANLYKFAQER-YKVTANNADAAADADVIILAVL 70 
                                                89******************9999999999999999999998887.677777788999********** PP

                                  TIGR00112  69 PqdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassev 136
                                                Pq+l+ vl+e++s  + +++l+iS++ Gv++++++++l+++ +++R+mPNta ++g+++t ia + ++
  lcl|FitnessBrowser__Pedo557:CA265_RS18505  71 PQQLNVVLEEIQSAINPAKHLVISVISGVSCAAVREKLDSNVQIIRAMPNTAIAIGQSMTCIASD-NA 137
                                                *************99999********************************************999.79 PP

                                  TIGR00112 137 seeqkelveellkavGkvveveeklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqt 204
                                                s+++ e v++++++vG+vv+++e+l+  +tal+++g Af++  i a+ ++gv+ G+ ++ea+++a qt
  lcl|FitnessBrowser__Pedo557:CA265_RS18505 138 SPQNLEDVTRMFETVGSVVKINEDLMTSATALCACGIAFFLRGIRAASQGGVEIGFHADEALKMAVQT 205
                                                99****************************************************************** PP

                                  TIGR00112 205 lkGaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrse 261
                                                 kGaa ll   g hp+  +dkVtsP+G+Tiagl+++e++g  s +i++++ ++ ++ 
  lcl|FitnessBrowser__Pedo557:CA265_RS18505 206 AKGAADLLLLHGTHPESEIDKVTSPKGCTIAGLNEMEHNGYSSSLIKGIKLSALKAG 262
                                                *************************************************99988775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (269 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 7.13
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory