GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serC in Pedobacter sp. GW460-11-11-14-LB5

Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate CA265_RS03895 CA265_RS03895 phosphoserine transaminase

Query= BRENDA::Q9RME2
         (361 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS03895 CA265_RS03895
           phosphoserine transaminase
          Length = 365

 Score =  320 bits (820), Expect = 4e-92
 Identities = 165/353 (46%), Positives = 235/353 (66%), Gaps = 4/353 (1%)

Query: 7   NFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPN 66
           NF AGP  LP   +E+A + ++N+    +S++E+SHRS  +E+V  + Q L+RELL +PN
Sbjct: 6   NFGAGPCILPSSVMEQAAQAVINWGGMGLSILEVSHRSPEFEDVVLKTQLLVRELLSVPN 65

Query: 67  DYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKAN 126
            Y +LFLQGGAS QF M+ MN L+ G    Y+ TG +++KA+KEAKL GE  + AS+K  
Sbjct: 66  HYSVLFLQGGASTQFAMVAMNFLSAGKKAAYLDTGYFAQKAIKEAKLFGEVELVASSKDK 125

Query: 127 SYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVN 186
            Y  IPD  +F +++  AY+H TSNNTI GT+  +F   N  P++ DMSSDI SR + V+
Sbjct: 126 DYAYIPD--QFNVDQESAYIHYTSNNTIEGTEIFDFSP-NGVPVVCDMSSDIFSRKINVS 182

Query: 187 QFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIY 246
            F +IYAGAQKN+GP+G+T+VI K + LN   +++P+M+ Y     + S+YNTPP FSIY
Sbjct: 183 DFDLIYAGAQKNMGPAGMTLVIAKNEFLNQAKKEIPSMMDYRIFRDNMSMYNTPPVFSIY 242

Query: 247 MLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRN 306
           +    L W+KD GG   I ++N EKAK++Y  ID +  FY G A+   RS MNVTF   N
Sbjct: 243 VAMLNLLWLKDQGGVSGIEQRNIEKAKLLYAEIDRNPLFY-GTADVAHRSRMNVTFLAVN 301

Query: 307 EELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE 359
           +++   FL  A +QG VG+ G+R+VGG RAS+YNA+P+ +   L   M  F++
Sbjct: 302 KDVEGGFLKFAADQGIVGIKGYRTVGGFRASLYNALPLSSVEVLVNAMASFEK 354


Lambda     K      H
   0.316    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 350
Number of extensions: 10
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 365
Length adjustment: 29
Effective length of query: 332
Effective length of database: 336
Effective search space:   111552
Effective search space used:   111552
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate CA265_RS03895 CA265_RS03895 (phosphoserine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.15460.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   3.2e-141  456.3   0.4   3.6e-141  456.1   0.4    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS03895  CA265_RS03895 phosphoserine tran


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS03895  CA265_RS03895 phosphoserine transaminase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  456.1   0.4  3.6e-141  3.6e-141       2     357 ..       5     355 ..       4     356 .. 0.98

  Alignments for each domain:
  == domain 1  score: 456.1 bits;  conditional E-value: 3.6e-141
                                  TIGR01364   2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 
                                                +nF+aGP++lp++v+e+a++ ++++ g+gls++e+sHRs efe+vv +++  +reLl++p++y+vlfl
  lcl|FitnessBrowser__Pedo557:CA265_RS03895   5 HNFGAGPCILPSSVMEQAAQAVINWGGMGLSILEVSHRSPEFEDVVLKTQLLVRELLSVPNHYSVLFL 72 
                                                8******************************************************************* PP

                                  TIGR01364  70 qGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelk 137
                                                qGGa+tqfa+v++n+l+++k+a+y+ tG++++ka+keak +++ v+ vas+++k+y  ip  ++++++
  lcl|FitnessBrowser__Pedo557:CA265_RS03895  73 QGGASTQFAMVAMNFLSAGKKAAYLDTGYFAQKAIKEAKLFGE-VELVASSKDKDYAYIP--DQFNVD 137
                                                *****************************************88.****************..789999 PP

                                  TIGR01364 138 edaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvi 205
                                                +++ay+++++n+tieG+e+ +    + +p+v+D+ssdi+srki+vs+++liyaGaqKn+GpaG+t+vi
  lcl|FitnessBrowser__Pedo557:CA265_RS03895 138 QESAYIHYTSNNTIEGTEIFDFS-PNGVPVVCDMSSDIFSRKINVSDFDLIYAGAQKNMGPAGMTLVI 204
                                                99****************99765.6889**************************************** PP

                                  TIGR01364 206 vrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllY 273
                                                 +++ l++akke+ps++dY+i  +n s+yntpp+f+iyv+ l l wlk++GGv+ +e++n eKakllY
  lcl|FitnessBrowser__Pedo557:CA265_RS03895 205 AKNEFLNQAKKEIPSMMDYRIFRDNMSMYNTPPVFSIYVAMLNLLWLKDQGGVSGIEQRNIEKAKLLY 272
                                                ******************************************************************** PP

                                  TIGR01364 274 eaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpl 341
                                                  id++  ++ ++++ ++Rs+mnv+F   ++++e  Flk a+++g+v++kG+r+vGG+Ras+Ynalpl
  lcl|FitnessBrowser__Pedo557:CA265_RS03895 273 AEIDRNP-LFYGTADVAHRSRMNVTFLAVNKDVEGGFLKFAADQGIVGIKGYRTVGGFRASLYNALPL 339
                                                ****997.666889****************************************************** PP

                                  TIGR01364 342 eevqaLvdfmkeFekk 357
                                                 +v+ Lv+ m +Fek 
  lcl|FitnessBrowser__Pedo557:CA265_RS03895 340 SSVEVLVNAMASFEKI 355
                                                *************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (365 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.45
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory