Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate GFF1736 PGA1_c17600 serine acetyltransferase-like protein
Query= curated2:P71405 (171 letters) >FitnessBrowser__Phaeo:GFF1736 Length = 112 Score = 92.4 bits (228), Expect = 2e-24 Identities = 46/89 (51%), Positives = 60/89 (67%) Query: 79 IDHGMGVVIGETTEIGDDVTIYHGVTLGGTGKFKGKRHPTLGNRVVVGAGAKVLGAICVG 138 IDH +VIGET +GD+V++ H VTLGGTGK + RHP +G+ V++GAGAKVLG I VG Sbjct: 2 IDHAHSIVIGETAVVGDNVSMLHSVTLGGTGKEEEDRHPKIGDGVLIGAGAKVLGNIKVG 61 Query: 139 DDVKIGANAVVLSDLPTGSTAVGSKAKTI 167 +I A +VVL +P T G AK + Sbjct: 62 HCSRIAAGSVVLQGIPPCKTVAGVPAKIV 90 Lambda K H 0.323 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 88 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 171 Length of database: 112 Length adjustment: 15 Effective length of query: 156 Effective length of database: 97 Effective search space: 15132 Effective search space used: 15132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory