Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (uncharacterized)
to candidate GFF761 PGA1_c07750 histidinol dehydrogenase HisD
Query= curated2:Q465R4 (433 letters) >FitnessBrowser__Phaeo:GFF761 Length = 435 Score = 267 bits (683), Expect = 4e-76 Identities = 152/412 (36%), Positives = 238/412 (57%), Gaps = 9/412 (2%) Query: 21 LSRGSGLEDVAKTVSTVLSDVRTKGDSALREYTAKFDKVELANFGVSEEEFQQALSGISP 80 L+ S + KTV +L D+ GD+ EY AKFD+ E N +++EE + A + + Sbjct: 11 LTPKSDASETHKTVQGILDDIEAGGDAKALEYAAKFDRYE-GNVLLTDEEIEAACALVPE 69 Query: 81 ELLDHLKSAAANIRAFHEAQLPKATWF---MELKPGIVLGQKATPLESVGAYAPGGRASY 137 +L ++ + N+R F A+L K+T E+ PG + GQK P+++ G Y PGGR S+ Sbjct: 70 KLKADIRFSHDNVRRF--AELQKSTMQNVETEICPGFITGQKVIPVDAAGCYVPGGRYSH 127 Query: 138 PSTVLMTVIPARVAGVEQVIVCTPPRPDGSVHPLTLAAAKVAGADKVFKLGGVQAIGSMA 197 ++ +MTV A+VAG + + C+PPRP V P + AA + GADK+ +GGVQ + +M Sbjct: 128 IASAIMTVTTAKVAGCKHITACSPPRPGVGVAPAIVYAAHICGADKIMAMGGVQGVAAMT 187 Query: 198 YGTETVPKVDKIVGPGNVFVTAAKMQIRDVAEIDFPAGPSEVLIIADESADAVMVASDIL 257 +G +PK + +VGPGN FV AK + ID AGP++ LI+AD +ADA +VA+D++ Sbjct: 188 FGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADRTADAHIVATDLV 247 Query: 258 AQSEHDPNSVSILVTGSDTLAEAVKREV---LVQAEQAARSSIIKSSLENAAILIADSLE 314 +Q+EH NS LVT LAE V R V + + R + + + A +++ E Sbjct: 248 SQAEHGYNSPVWLVTDDRALAEEVMRLVPGLIDDLPEVNRENAAAAWRDYAEVILCSDRE 307 Query: 315 QCIGFSNKFAPEHLEIMVADPDFVLDRIKNAGSIFIGNYSPVPVGDYASGTNHVLPTSGY 374 + S+ +APEHL + D D+ L ++ GS+F+G + V GD A+GTNHVLPTS Sbjct: 308 EMAACSDDYAPEHLTVQAEDLDWWLGQLTCYGSLFLGEETTVSYGDKAAGTNHVLPTSRA 367 Query: 375 ARVYSGLNINHFIKYSSIQRISKSGLESLKETVIALAEEEGLQAHADAIRTR 426 A GL+++ ++K + QR ++ G +++ E +A EG++ HA A R Sbjct: 368 ASYTGGLSVHKYMKIVTWQRATREGSKAVAEATARIARLEGMEGHARAADVR 419 Lambda K H 0.315 0.131 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 433 Length of database: 435 Length adjustment: 32 Effective length of query: 401 Effective length of database: 403 Effective search space: 161603 Effective search space used: 161603 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate GFF761 PGA1_c07750 (histidinol dehydrogenase HisD)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.20863.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-137 444.5 0.1 2.3e-137 444.3 0.1 1.0 1 lcl|FitnessBrowser__Phaeo:GFF761 PGA1_c07750 histidinol dehydroge Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF761 PGA1_c07750 histidinol dehydrogenase HisD # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.3 0.1 2.3e-137 2.3e-137 1 393 [] 24 419 .. 24 419 .. 0.98 Alignments for each domain: == domain 1 score: 444.3 bits; conditional E-value: 2.3e-137 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlpes..veve 75 v+ i++d+++ Gd+ ley+ kfd+++ ++ +++ee+e+a + v+e+lk++++ +++n+++f+e q+++ ve+e lcl|FitnessBrowser__Phaeo:GFF761 24 VQGILDDIEAGGDAKALEYAAKFDRYE-GNVLLTDEEIEAACALVPEKLKADIRFSHDNVRRFAELQKSTMqnVETE 99 789***********************6.899**********************************998654349999 PP TIGR00069 76 teegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdevyk 152 + +g ++gqkv p++++g+YvPgG+++++++++mt+ +AkvAg+k+i++++Pp+ v+pa+++aa+++g+d++++ lcl|FitnessBrowser__Phaeo:GFF761 100 ICPGFITGQKVIPVDAAGCYVPGGRYSHIASAIMTVTTAKVAGCKHITACSPPRPGVGVAPAIVYAAHICGADKIMA 176 99***************************************************98888******************* PP TIGR00069 153 vGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqaEHd 229 +GG+q++aa+++G+ +pk++++vGPGn++V++AK+++fg+vgidmiaGP++ l++ad++a++++va+Dl+sqaEH+ lcl|FitnessBrowser__Phaeo:GFF761 177 MGGVQGVAAMTFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADRTADAHIVATDLVSQAEHG 253 ***************************************************************************** PP TIGR00069 230 edaqailvttseelaekveeeveeqleele..rkeiaekslekngaiilvddleealelsneyApEHLelqtkdpee 304 ++ ++lvt++++lae+v + v +++l+ ++e a +++++++++il++d ee++++s++yApEHL++q++d lcl|FitnessBrowser__Phaeo:GFF761 254 YNSPVWLVTDDRALAEEVMRLVPGLIDDLPevNRENAAAAWRDYAEVILCSDREEMAACSDDYAPEHLTVQAEDLDW 330 *****************************9667999***************************************** PP TIGR00069 305 llkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeaveklaeaE 381 +l +++ +Gs+flGe t++++gd++aG+nhvLPTs++A +++glsv++++k +++q++++e+ +++aea++++a++E lcl|FitnessBrowser__Phaeo:GFF761 331 WLGQLTCYGSLFLGEETTVSYGDKAAGTNHVLPTSRAASYTGGLSVHKYMKIVTWQRATREGSKAVAEATARIARLE 407 ***************************************************************************** PP TIGR00069 382 gLeaHaeavevR 393 g+e Ha+a++vR lcl|FitnessBrowser__Phaeo:GFF761 408 GMEGHARAADVR 419 ********9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (435 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.24 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory