Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate GFF3239 PGA1_c32920 dihydrodipicolinate reductase DapB
Query= CharProtDB::CH_002128 (273 letters) >lcl|FitnessBrowser__Phaeo:GFF3239 PGA1_c32920 dihydrodipicolinate reductase DapB Length = 273 Score = 211 bits (537), Expect = 1e-59 Identities = 115/263 (43%), Positives = 151/263 (57%) Query: 8 VAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLD 67 + I GA GRMG+ LI+ L A+EREG +G D G G + G+TV Sbjct: 11 IVITGASGRMGQMLIKTIADHPRAHLVGAVEREGHDWVGQDVGLAMGGSEIGITVTDDAP 70 Query: 68 AVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAA 127 A IDFT PE T+ + G VIGTTG ++A + A+ + A Sbjct: 71 AAFAKAQAVIDFTSPEATIAFAGMAAEAGVVHVIGTTGMNDAQIVQLEPASRHSVQMRAG 130 Query: 128 NFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLK 187 N S+GVN++++L +K A + + DIE+IEAHH HKVDAPSGTAL +GEA A L Sbjct: 131 NMSLGVNLLVQLTKKVAAALDEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVTLS 190 Query: 188 DCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGA 247 D + R+G TG R G IGF+ +R GDIVGEH +FA GER+ + H A+ R FA GA Sbjct: 191 DVSDSGRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGERIVLRHLATDRAIFARGA 250 Query: 248 VRSALWLSGKESGLFDMRDVLDL 270 +++ALW GKE G +DM DVL L Sbjct: 251 IKAALWGQGKEPGQYDMLDVLGL 273 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 273 Length adjustment: 25 Effective length of query: 248 Effective length of database: 248 Effective search space: 61504 Effective search space used: 61504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF3239 PGA1_c32920 (dihydrodipicolinate reductase DapB)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.31024.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-84 267.8 6.0 6.8e-84 267.5 6.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3239 PGA1_c32920 dihydrodipicolinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3239 PGA1_c32920 dihydrodipicolinate reductase DapB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 267.5 6.0 6.8e-84 6.8e-84 4 270 .] 11 272 .. 9 272 .. 0.97 Alignments for each domain: == domain 1 score: 267.5 bits; conditional E-value: 6.8e-84 TIGR00036 4 vavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvlaekkadvliDf 79 ++++Ga+GrmG+ +ik++++++ +lv+a+er+g++ +g+D+G +g +++g++v+dd a+ ka+ +iDf lcl|FitnessBrowser__Phaeo:GFF3239 11 IVITGASGRMGQMLIKTIADHPRAHLVGAVEREGHDWVGQDVGLAMGGSEIGITVTDDAPAA----FAKAQAVIDF 82 89********************************************************9987....778899**** PP TIGR00036 80 ttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnlllkllekaakvle.dvDi 154 t pea+ + +a+e+gv V+GTTG++++++ +l+ ++ + +v + a N+++Gvnll++l++k+a l+ d+Di lcl|FitnessBrowser__Phaeo:GFF3239 83 TSPEATIAFAGMAAEAGVVHVIGTTGMNDAQIVQLEPASRH-SV-QMRAGNMSLGVNLLVQLTKKVAAALDeDFDI 156 *************************************9999.55.569*****************999997256** PP TIGR00036 155 EiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGiaavRggdvvgehtvlFasdGe 230 E+iE+HH+hK+DaPSGTAl l+e+ a+ rg +l+++ ++r+g+tG+rk+ +iG++a+Rggd+vgeh vlFa++Ge lcl|FitnessBrowser__Phaeo:GFF3239 157 EVIEAHHHHKVDAPSGTALMLGEAAAEGRGVTLSDVSDSGRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGE 232 **************************************************************************** PP TIGR00036 231 rleitHkassRaafakGvvrairwledkeekvydledvld 270 r+ ++H a++Ra+fa+G+++a+ w + ke + yd+ dvl+ lcl|FitnessBrowser__Phaeo:GFF3239 233 RIVLRHLATDRAIFARGAIKAALWGQGKEPGQYDMLDVLG 272 **************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory