Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate GFF3576 PGA1_c36310 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase DapD
Query= SwissProt::P56220 (274 letters) >FitnessBrowser__Phaeo:GFF3576 Length = 275 Score = 334 bits (856), Expect = 1e-96 Identities = 174/272 (63%), Positives = 209/272 (76%), Gaps = 5/272 (1%) Query: 3 QLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKID-GQWVTHQWLKK 61 QL+ IE+A+E R IT A R+A+ + + LDSG LRVAE+ D G W +QW KK Sbjct: 5 QLETAIEAAWEARDTITSATTGE-QRDAIEETLNALDSGKLRVAERQDSGNWHVNQWAKK 63 Query: 62 AVLLSFRINDNKVMDGAE--TRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIAR 119 AVLL FRI D + G + ++DKV KF + EA +++ GFR VP VR+ A+IA Sbjct: 64 AVLLGFRIKDMEEQSGGPQGSGWWDKVDSKFKGWGEAEWKEAGFRAVPNCVVRKSAYIAP 123 Query: 120 NTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179 VLMPS+VN+GA+VDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEP+QA PTIIE Sbjct: 124 GVVLMPSFVNLGAHVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183 Query: 180 DNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLP 239 DNCFIGARSEVVEG IV EGSV+ MGV++GQST+I DRETGE+ YG VP SVVV+G++P Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243 Query: 240 SKDGSYSLYCAVIVKKVDAKTRGKVGINELLR 271 SK+G +LYCAVIVK+VD +TR K GINELLR Sbjct: 244 SKNG-INLYCAVIVKRVDERTRSKTGINELLR 274 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 275 Length adjustment: 25 Effective length of query: 249 Effective length of database: 250 Effective search space: 62250 Effective search space used: 62250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate GFF3576 PGA1_c36310 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase DapD)
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.11020.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-130 420.5 0.9 1.7e-130 420.3 0.9 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3576 PGA1_c36310 2,3,4,5-tetrahydropy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3576 PGA1_c36310 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Dap # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 420.3 0.9 1.7e-130 1.7e-130 2 269 .. 6 274 .. 5 275 .] 0.96 Alignments for each domain: == domain 1 score: 420.3 bits; conditional E-value: 1.7e-130 TIGR00965 2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekl.dgqwkvnewvkkavllsfritdnqvlnda 76 l ie a+e r+ i+ a+ + + ++a++e+++ ldsg+lrvae++ +g+w+vn+w+kkavll fri+d + ++ lcl|FitnessBrowser__Phaeo:GFF3576 6 LETAIEAAWEARDTITSAT-TGEQRDAIEETLNALDSGKLRVAERQdSGNWHVNQWAKKAVLLGFRIKDMEEQSGG 80 6789***********9876.5788**********************789*******************98877765 PP TIGR00965 77 ..vnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtmvdtwatvgscaqi 150 + ++dkv +kf + e+e+keag+r+vp+ vvr+ a+ia vvlmps+vn+ga+vdegtmvdtwatvgscaqi lcl|FitnessBrowser__Phaeo:GFF3576 81 pqGSGWWDKVDSKFKGWGEAEWKEAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAHVDEGTMVDTWATVGSCAQI 156 22678*********************************************************************** PP TIGR00965 151 gknvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvfigqstkivdretgeiiygrvp 226 gknvhlsggvgiggvlep+qa p+iiedncfigarse+veg iv egsv+ mgvfigqstkivdretge++yg vp lcl|FitnessBrowser__Phaeo:GFF3576 157 GKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVP 232 **************************************************************************** PP TIGR00965 227 agsvvvsgslpskdgkkslycavivkkvdaktrgkvsinellr 269 +svvv+gs+psk+g +lycavivk+vd++tr+k++inellr lcl|FitnessBrowser__Phaeo:GFF3576 233 PYSVVVAGSMPSKNGI-NLYCAVIVKRVDERTRSKTGINELLR 274 **************95.7************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.46 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory