Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate GFF3587 PGA1_c36420 succinyl-diaminopimelate desuccinylase DapE
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__Phaeo:GFF3587 Length = 385 Score = 259 bits (662), Expect = 9e-74 Identities = 152/371 (40%), Positives = 205/371 (55%), Gaps = 8/371 (2%) Query: 8 ELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAP--VVCF 65 +L +LI SVTP++ LL + L GF + G+ N+ R G K + F Sbjct: 10 QLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGDKGHPRTMGF 69 Query: 66 AGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNHQG 125 GHTDVVP G W PF E+DG LYGRGA DMK+ +A FV A V P G Sbjct: 70 NGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDLVQTTPP-DG 128 Query: 126 SIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRGSLSG 185 +I L IT DEEGDA+DGTT ++D + E + C+VGEPT DK+G+MIK GRRGSLS Sbjct: 129 AILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMGEMIKIGRRGSLSA 188 Query: 186 NLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGGTGAT 245 TV G QGH AYPH A NP++ + L D+G E+F ++ + I+ G AT Sbjct: 189 WFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVTIDTGNPAT 248 Query: 246 NVIPGELNVKFNFRFSTESTEAGLKQRVHA----ILDKHGVQYDLQWSCSGQPFLTQAGK 301 NVIP + N RF+ T A L + A GV ++ SG+ F+T G Sbjct: 249 NVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGESFITPPGP 308 Query: 302 LTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDI 361 L+D+ AA+ G + +LSTTGGTSD RF+K ++E+G T+HQ++E V + I Sbjct: 309 LSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHC-PVVEVGLVGKTMHQVDERVEIAQI 367 Query: 362 PKLSAVYEGIL 372 +L ++Y IL Sbjct: 368 HQLKSIYGRIL 378 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 385 Length adjustment: 30 Effective length of query: 351 Effective length of database: 355 Effective search space: 124605 Effective search space used: 124605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate GFF3587 PGA1_c36420 (succinyl-diaminopimelate desuccinylase DapE)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.4644.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-118 382.3 0.0 1.4e-118 382.1 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3587 PGA1_c36420 succinyl-diaminopime Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3587 PGA1_c36420 succinyl-diaminopimelate desuccinylase DapE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 382.1 0.0 1.4e-118 1.4e-118 3 368 .. 10 379 .. 8 381 .. 0.96 Alignments for each domain: == domain 1 score: 382.1 bits; conditional E-value: 1.4e-118 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt..eepvlvfaGhtDvvPaGelekWs 76 +l+ +Li+ svtP++ ga+ l+++ L++ gf++ ++ +++ nl a+ g + ++ f GhtDvvP+G++++W+ lcl|FitnessBrowser__Phaeo:GFF3587 10 QLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGDkgHPRTMGFNGHTDVVPVGDTNAWT 85 6899*******************************************998854456899***************** PP TIGR01246 77 sdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdeli 152 dpf +ee+dG+lygrGa+Dmk+++aafv+aa + v+ + G + l it Deeg+aidGt+++++ + e++ lcl|FitnessBrowser__Phaeo:GFF3587 86 VDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDLVQTTP-PDGAILLTITGDEEGDAIDGTTALLDHMDREGEQM 160 *********************************9998776.58********************************* PP TIGR01246 153 dyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppssl 228 ++vgeP++ +k+G++ikiGrrGs+++ ++++G+qGh aYPh+a+nP++ +v+++ +l++ +lD+G+e+f +s l lcl|FitnessBrowser__Phaeo:GFF3587 161 AVCLVGEPTCPDKMGEMIKIGRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTL 236 **************************************************************************** PP TIGR01246 229 qianieagtgasnviPgelkvkfnlrfssevseeel....kskvekildkhkldYelewklsgepfltkegklikk 300 + i++g+ a+nviP++ + + n+rf+ ++ +el + + ++ +++++d +e k+sge+f+t g l + lcl|FitnessBrowser__Phaeo:GFF3587 237 AVVTIDTGNPATNVIPAQTRSTVNIRFNDAHTGAELsdwlRAEAARAAKDFGVDIAVEIKVSGESFITPPGPLSDL 312 *****************************9998776111166777788899************************* PP TIGR01246 301 vaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklle 368 v +a+e +++kp+lst+GGtsDarf+++ + vve+Glv +t+h+v+e+v+i+++++l+++y ++l+ lcl|FitnessBrowser__Phaeo:GFF3587 313 VSAAVETETGRKPQLSTTGGTSDARFVKNH-CPVVEVGLVGKTMHQVDERVEIAQIHQLKSIYGRILR 379 *****************************9.********************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory