Align Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 (characterized)
to candidate GFF1439 PGA1_c14560 homoserine O-succinyltransferase MetA
Query= SwissProt::G4RES5 (306 letters) >FitnessBrowser__Phaeo:GFF1439 Length = 305 Score = 353 bits (906), Expect = e-102 Identities = 153/304 (50%), Positives = 223/304 (73%), Gaps = 2/304 (0%) Query: 1 MPIRIPDQLPARKTLETEGVVVMDQSRSARQDIRPLQFGLLNLMPNKQRTETQFARLIAS 60 MPI+IP LPA L EGV+VM ++ARQDIRPL+ GLLNLMP K +TE QFARLI + Sbjct: 1 MPIKIPSDLPAYDVLTNEGVMVMSPDQAARQDIRPLRIGLLNLMPKKIQTENQFARLIGA 60 Query: 61 TPLQIDLTLVRVADPLSKSTPEDYLQNFYSTWEDVRAKKFDGFVVTGAPIANMPFEDVRY 120 TPLQIDL+L+R+ + +++T +++ FY +++++ ++FDG ++TGAPI ++ FEDV Y Sbjct: 61 TPLQIDLSLIRMTEHQTRNTAAEHMAEFYRPFQEIKDQRFDGLIITGAPIEHLEFEDVTY 120 Query: 121 WPEMLEIMDWTQTNVHHTMFICWGAQAALHHLHGVKRYRMEHKAFGVYRHKVLDTRHPFL 180 W E+ E+ DWTQTNVH T +CWG A +++ HGVK++ ++HK FG +RH+ LD P+L Sbjct: 121 WDELCEVFDWTQTNVHSTFGVCWGGMAMINYFHGVKKHLLDHKVFGCFRHQNLDPASPYL 180 Query: 181 RGFSDDLAVPVSRYNDIDRQSLS--PDLDILIDSDEVGICMLDDRKYRAAYMLNHLEYDN 238 RGFSDD +PVSR+ +I + + P L L+ S + G C+++D +RA Y+ NH EYD+ Sbjct: 181 RGFSDDCVIPVSRWTEIRQSEIDARPGLRSLLGSQDAGPCLIEDPSHRALYIFNHFEYDS 240 Query: 239 TSLADEYHRDIEAGLDTPLPVNLFPGNDPSRMPENRWRSHAHLLFQNWINEIYQTTPYEL 298 +L EY RD+ +G +P+N +P +DPSR P+NRWRSHAHLL+ NWIN+IYQ+TP+++ Sbjct: 241 DTLKQEYDRDVASGTPINVPMNYYPDDDPSRKPQNRWRSHAHLLYGNWINDIYQSTPFDM 300 Query: 299 EKVG 302 ++G Sbjct: 301 AEIG 304 Lambda K H 0.321 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 305 Length adjustment: 27 Effective length of query: 279 Effective length of database: 278 Effective search space: 77562 Effective search space used: 77562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF1439 PGA1_c14560 (homoserine O-succinyltransferase MetA)
to HMM TIGR01001 (metA: homoserine O-succinyltransferase (EC 2.3.1.46))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01001.hmm # target sequence database: /tmp/gapView.25561.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01001 [M=301] Accession: TIGR01001 Description: metA: homoserine O-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-114 366.5 0.0 7.3e-114 366.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1439 PGA1_c14560 homoserine O-succiny Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1439 PGA1_c14560 homoserine O-succinyltransferase MetA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 366.3 0.0 7.3e-114 7.3e-114 1 300 [. 1 300 [. 1 301 [. 0.99 Alignments for each domain: == domain 1 score: 366.3 bits; conditional E-value: 7.3e-114 TIGR01001 1 mpirvpdelpavellkeenifvmtekrashqdirplevlilnlmpkkietenqllrllsnsplqvditllridsrk 76 mpi++p++lpa+++l +e+++vm+ +a qdirpl++ +lnlmpkki+tenq+ rl++ +plq+d+ l+r+++++ lcl|FitnessBrowser__Phaeo:GFF1439 1 MPIKIPSDLPAYDVLTNEGVMVMSPDQAARQDIRPLRIGLLNLMPKKIQTENQFARLIGATPLQIDLSLIRMTEHQ 76 9*************************************************************************** PP TIGR01001 77 skntpiehlekfykeleevkdrkfdGlivtGapvellefedvayweelkeilewskenvtstlyicwaaqaalkll 152 ++nt +eh+ +fy+ ++e+kd++fdGli+tGap+e lefedv yw+el e+++w+++nv st+ +cw+ +a ++++ lcl|FitnessBrowser__Phaeo:GFF1439 77 TRNTAAEHMAEFYRPFQEIKDQRFDGLIITGAPIEHLEFEDVTYWDELCEVFDWTQTNVHSTFGVCWGGMAMINYF 152 **************************************************************************** PP TIGR01001 153 ygipkrtleeklsGvykhdiv.kedlllrgfddkflaphsryadldeeliaeltdleilaesdeagvylaaskder 227 +g++k+ l++k++G ++h+ + + ++ lrgf d ++p sr++++ + +i++ + l l+ s++ag l+ ++r lcl|FitnessBrowser__Phaeo:GFF1439 153 HGVKKHLLDHKVFGCFRHQNLdPASPYLRGFSDDCVIPVSRWTEIRQSEIDARPGLRSLLGSQDAGPCLIEDPSHR 228 *******************99899**************************************************** PP TIGR01001 228 nifvtGhpeydketlrqeyvrdvgeglkvdipknyypkddpektpiaswrshanllfanwlnyavyqktpydl 300 +++ h eyd +tl+qey rdv +g +++p+nyyp+ddp+++p wrsha+ll+ nw+n ++yq+tp+d+ lcl|FitnessBrowser__Phaeo:GFF1439 229 ALYIFNHFEYDSDTLKQEYDRDVASGTPINVPMNYYPDDDPSRKPQNRWRSHAHLLYGNWIN-DIYQSTPFDM 300 *************************************************************9.8*******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (301 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory