Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate GFF1638 PGA1_c16600 methionine gamma-lyase MdeA
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__Phaeo:GFF1638 Length = 401 Score = 308 bits (790), Expect = 1e-88 Identities = 174/392 (44%), Positives = 236/392 (60%), Gaps = 12/392 (3%) Query: 16 SLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSP--------GEHQGFEYSRTHNPTRF 67 S +T AIH G G++ PP+Y TST+ S GE +G YSR NPT Sbjct: 7 SFSTRAIHHGYDTQSQQGSLNPPLYLTSTFTFDSAEAGGEMFTGEREGHFYSRISNPTLD 66 Query: 68 AYERCVAALEGGTRAFAFASGMAA-TSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRT 126 E+ +A LEGG A ASGM A TST+ L AG ++ LYG TF R Sbjct: 67 HLEQRIANLEGGEAGLATASGMGAITSTLWSFLAAGDEIILDKTLYGCTFSFMTHGLPRF 126 Query: 127 AGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDN 186 G+ VD+TDP AI TK+V+ ETP NP +L+DIAAI+ IA K G VVDN Sbjct: 127 -GVKVRLVDMTDPTNLAEAISPKTKLVYFETPANPNNRLIDIAAISEIAHKAGAKVVVDN 185 Query: 187 TFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAE-QMAFLQNSIGGV 245 TFA+P+L RP+ LGAD+VVHSATK+++GH D++ G+ VVG E+ + ++ L++ G V Sbjct: 186 TFATPVLTRPIELGADIVVHSATKFISGHGDVIAGL-VVGSKEEITQIRLVGLKDMTGAV 244 Query: 246 QGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQ 305 PF + L +RGLKTL LRM HC++AL +A+ L+ HPA+E+V YPGL Q LA+RQ Sbjct: 245 MSPFSAMLLMRGLKTLELRMERHCKSALKVAEALQAHPAVERVYYPGLDDFAQGDLARRQ 304 Query: 306 MSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQ 365 MSGFGG++ + GG + + A SLG E+L+ HPA MTH++ R + Sbjct: 305 MSGFGGMIPFEVVGGKAGGIAMMNRLAMIQRAVSLGDAETLIQHPASMTHSTYTPEERAE 364 Query: 366 LGISDALVRLSVGIEDLGDLRGDLERALVNQN 397 GI++ LVR+SVG+E + D+ DL +AL + N Sbjct: 365 HGIAEGLVRMSVGLEGVDDIIDDLMQALSSHN 396 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory