GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argC in Phaeobacter inhibens BS107

Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC

Query= SwissProt::Q93Z70
         (401 letters)



>FitnessBrowser__Phaeo:GFF1682
          Length = 342

 Score =  361 bits (926), Expect = e-104
 Identities = 180/343 (52%), Positives = 238/343 (69%), Gaps = 5/343 (1%)

Query: 60  RIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKD 119
           ++ +LGASGYTGAE+VRL++ HP  ++  ++A+RKAG +M  VFPHLR  +LP L  + +
Sbjct: 4   KVAILGASGYTGAELVRLISQHPTIEIAALSAERKAGMTMAQVFPHLRHLELPVLCKIGE 63

Query: 120 ADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQ 179
            DF+ +D  FC LPH T+QE+I  LP  LKIVDLSADFRLR+  EYE+WYG PH A+  Q
Sbjct: 64  IDFTGIDLCFCALPHKTSQEVIAALPQDLKIVDLSADFRLRDPDEYEKWYGNPHAALAQQ 123

Query: 180 KEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGA 239
           KE VYGL+E  RE+IK ARLVA  GC   T Q  L PL+ + +I  ++II+D K  VSGA
Sbjct: 124 KEAVYGLSEFYREEIKSARLVAGTGCNAATGQFALRPLIASGVIDLDDIILDLKCAVSGA 183

Query: 240 GRGAKEANLYSEIAEGISSYGV-TRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQ 298
           GR  KE  L++E++EG   Y V   HRH+ E +Q  S +A   V V FTPHL+P  RG+ 
Sbjct: 184 GRSLKENLLHAELSEGYHGYAVGGTHRHLGEFDQEFSKIAGRPVKVQFTPHLVPANRGIL 243

Query: 299 STIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIP 358
           +T+YV+       + +HQ L T+Y DE F+++L  G  P T ++RGSN+CH+ V  DRI 
Sbjct: 244 ATVYVK----GDAQTIHQTLATAYADEPFIELLPFGEAPSTRHIRGSNFCHIGVAADRIE 299

Query: 359 GRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
           GR I+I+ +DNL KG+SGQALQN N+MLG  ETTGL+  PLFP
Sbjct: 300 GRTIVIAALDNLTKGSSGQALQNANLMLGEEETTGLMMAPLFP 342


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 414
Number of extensions: 10
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 342
Length adjustment: 30
Effective length of query: 371
Effective length of database: 312
Effective search space:   115752
Effective search space used:   115752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate GFF1682 PGA1_c17050 (N-acetyl-gamma-glutamyl-phosphate reductase ArgC)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

Software error:

../bin/blast/fastacmd -i /tmp/list.11525.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.11525.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.