GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argD in Phaeobacter inhibens BS107

Align Acetylornithine aminotransferase 2; ACOAT 2; EC 2.6.1.11 (uncharacterized)
to candidate GFF3422 PGA1_c34750 putative aminotransferase class 3

Query= curated2:Q882K8
         (400 letters)



>lcl|FitnessBrowser__Phaeo:GFF3422 PGA1_c34750 putative
            aminotransferase class 3
          Length = 1009

 Score =  187 bits (475), Expect = 1e-51
 Identities = 135/408 (33%), Positives = 210/408 (51%), Gaps = 43/408 (10%)

Query: 19   RGLGTRLWDQSGREYLDAVAGVAVTNVGHSHPMLVDAIRDQAGLLLHTSNLYSIDWQQRL 78
            RG    L+D+ GR YLDA   V   +VGH+HP +     DQ   + +++  Y    Q   
Sbjct: 609  RGWKHHLFDEWGRPYLDAYNNVP--HVGHAHPRIQAIAADQLKRM-NSNTRYLHPAQNAF 665

Query: 79   AQK-LTRLAG-MDRVFFNNSGAEANETALKLARLHGWHKYIEQPLVVVMENAFHGRTLGT 136
            A+K L+++   ++  FF NSG EANE AL+LAR H   K +  P     ++ +HG T G 
Sbjct: 666  AEKILSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTP-----DHGYHGNTTGA 720

Query: 137  LAASD---------GPAVRLSYSDLPGDYIKV----------PFGDLL--AFDKVCVTHG 175
            +  S          GP+  +   ++  DY              + DL+  A  K+  + G
Sbjct: 721  IDISAYKFNAKGGVGPSDWVELVEVADDYRGTYGRDDPQRAQKYADLVDPAIAKLQAS-G 779

Query: 176  HRIAAVLVEPIQGEGGAQVAPAGYLKALRERCTRRDWLLMLDEIQTGMGRTGKW-FAFQH 234
            H +A  + E     GG  + P GYL A+ E+      + + DE+QTG+GR G++ F F+H
Sbjct: 780  HGVAGFIAETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLGEYYFGFEH 839

Query: 235  EGIVPDVMTLAKGLGNGVPIGACLARGKAAELFTPGSHG-STFGGNPLACRVGCTVIDII 293
            +G  PD++ L K +GNG P+G  +     A+ F  G    STFGG+ L+CR+G  V++I+
Sbjct: 840  QGASPDIVVLGKPIGNGHPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSCRIGTEVLNIV 899

Query: 294  EQQALVENAGVRGQHLLGRLQEVLGGHPQVMQVRGRGLMIGIEL-REAIPELTRIAA--- 349
            +++ L ENA  RG  LL  L+++   H  +  VRG GL IG+EL R    E + I A   
Sbjct: 900  DEEGLQENARQRGADLLNGLRDLQSRHQAIGDVRGMGLFIGVELIRTDGSEASEICAYVK 959

Query: 350  ---EQHGLLINV--TRGKVIRLLPPLVLEAAEVEQIVQGLAASLDSAS 392
                 H +LI     +  ++++ PPL ++A  +E I++ L + L   S
Sbjct: 960  NRMRDHRILIGSEGPKDNILKIRPPLTIDAEGIEMILKTLDSILSELS 1007


Lambda     K      H
   0.322    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 948
Number of extensions: 55
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 1009
Length adjustment: 38
Effective length of query: 362
Effective length of database: 971
Effective search space:   351502
Effective search space used:   351502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory