Align Acetylornithine aminotransferase 2; ACOAT 2; EC 2.6.1.11 (uncharacterized)
to candidate GFF3422 PGA1_c34750 putative aminotransferase class 3
Query= curated2:Q882K8 (400 letters) >FitnessBrowser__Phaeo:GFF3422 Length = 1009 Score = 187 bits (475), Expect = 1e-51 Identities = 135/408 (33%), Positives = 210/408 (51%), Gaps = 43/408 (10%) Query: 19 RGLGTRLWDQSGREYLDAVAGVAVTNVGHSHPMLVDAIRDQAGLLLHTSNLYSIDWQQRL 78 RG L+D+ GR YLDA V +VGH+HP + DQ + +++ Y Q Sbjct: 609 RGWKHHLFDEWGRPYLDAYNNVP--HVGHAHPRIQAIAADQLKRM-NSNTRYLHPAQNAF 665 Query: 79 AQK-LTRLAG-MDRVFFNNSGAEANETALKLARLHGWHKYIEQPLVVVMENAFHGRTLGT 136 A+K L+++ ++ FF NSG EANE AL+LAR H K + P ++ +HG T G Sbjct: 666 AEKILSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTP-----DHGYHGNTTGA 720 Query: 137 LAASD---------GPAVRLSYSDLPGDYIKV----------PFGDLL--AFDKVCVTHG 175 + S GP+ + ++ DY + DL+ A K+ + G Sbjct: 721 IDISAYKFNAKGGVGPSDWVELVEVADDYRGTYGRDDPQRAQKYADLVDPAIAKLQAS-G 779 Query: 176 HRIAAVLVEPIQGEGGAQVAPAGYLKALRERCTRRDWLLMLDEIQTGMGRTGKW-FAFQH 234 H +A + E GG + P GYL A+ E+ + + DE+QTG+GR G++ F F+H Sbjct: 780 HGVAGFIAETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLGEYYFGFEH 839 Query: 235 EGIVPDVMTLAKGLGNGVPIGACLARGKAAELFTPGSHG-STFGGNPLACRVGCTVIDII 293 +G PD++ L K +GNG P+G + A+ F G STFGG+ L+CR+G V++I+ Sbjct: 840 QGASPDIVVLGKPIGNGHPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSCRIGTEVLNIV 899 Query: 294 EQQALVENAGVRGQHLLGRLQEVLGGHPQVMQVRGRGLMIGIEL-REAIPELTRIAA--- 349 +++ L ENA RG LL L+++ H + VRG GL IG+EL R E + I A Sbjct: 900 DEEGLQENARQRGADLLNGLRDLQSRHQAIGDVRGMGLFIGVELIRTDGSEASEICAYVK 959 Query: 350 ---EQHGLLINV--TRGKVIRLLPPLVLEAAEVEQIVQGLAASLDSAS 392 H +LI + ++++ PPL ++A +E I++ L + L S Sbjct: 960 NRMRDHRILIGSEGPKDNILKIRPPLTIDAEGIEMILKTLDSILSELS 1007 Lambda K H 0.322 0.138 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 948 Number of extensions: 55 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 1009 Length adjustment: 38 Effective length of query: 362 Effective length of database: 971 Effective search space: 351502 Effective search space used: 351502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory